BD2 (DEFB4A) Rabbit Polyclonal Antibody

SKU TA342869

Rabbit Polyclonal Anti-DEFB4A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DEFB4A antibody: synthetic peptide directed towards the N terminal of human DEFB4A. Synthetic peptide located within the following region: LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 4 kDa
• Gene Name: defensin beta 4A
• Database Link:
  NP_004933
  O15263
• Background: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. DEFB4A is locally regulated by inflammation.
• Synonyms: BD-2; DEFB-2; DEFB2; DEFB4; DEFB102; HBD-2; SAP1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane