UBE2D2 (NM_003339) Human Tagged ORF Clone

SKU
RG218795
UBE2D2 (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2D2
Synonyms E2(17)KB2; PUBC1; UBC4; UBC4/5; UBCH4; UBCH5B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG218795 representing NM_003339
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGAAGAGAATCCACAAGGAATTGAATGATCTGGCACGGGACCCTCCAGCACAGTGTTCAGCAG
GTCCTGTTGGAGATGATATGTTCCATTGGCAAGCTACAATAATGGGGCCAAATGACAGTCCCTATCAGGG
TGGAGTATTTTTCTTGACAATTCATTTCCCAACAGATTACCCCTTCAAACCACCTAAGGTTGCATTTACA
ACAAGAATTTATCATCCAAATATTAACAGTAATGGCAGCATTTGTCTTGATATTCTACGATCACAGTGGT
CTCCAGCACTAACTATTTCAAAAGTACTCTTGTCCATCTGTTCTCTGTTGTGTGATCCCAATCCAGATGA
TCCTTTAGTGCCTGAGATTGCTCGGATCTACAAAACAGATAGAGAAAAGTACAACAGAATAGCTCGGGAA
TGGACTCAGAAGTATGCGATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG218795 representing NM_003339
Red=Cloning site Green=Tags(s)

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE
WTQKYAM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003339
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003339.3
RefSeq Size 2715 bp
RefSeq ORF 444 bp
Locus ID 7322
UniProt ID P62837
Cytogenetics 5q31.2
Domains UBCc
Protein Pathways Ubiquitin mediated proteolysis
Summary Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]
Write Your Own Review
You're reviewing:UBE2D2 (NM_003339) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218795 UBE2D2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1 10 ug
$150.00
RC218795L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC218795L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1, mGFP tagged 10 ug
$450.00
RC218795L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC218795L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1, mGFP tagged 10 ug
$450.00
SC111700 UBE2D2 (untagged)-Human ubiquitin-conjugating enzyme E2D 2 (UBE2D2), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.