GADD45A (NM_001924) Human Tagged ORF Clone

SKU
RG204005
GADD45A (tGFP-tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GADD45A
Synonyms DDIT1; GADD45
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204005 representing NM_001924
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTTGGAGGAATTCTCGGCTGGAGAGCAGAAGACCGAAAGGATGGATAAGGTGGGGGATGCCCTGG
AGGAAGTGCTCAGCAAAGCCCTGAGTCAGCGCACGATCACTGTCGGGGTGTACGAAGCGGCCAAGCTGCT
CAACGTCGACCCCGATAACGTGGTGTTGTGCCTGCTGGCGGCGGACGAGGACGACGACAGAGATGTGGCT
CTGCAGATCCACTTCACCCTGATCCAGGCGTTTTGCTGCGAGAACGACATCAACATCCTGCGCGTCAGCA
ACCCGGGCCGGCTGGCGGAGCTCCTGCTCTTGGAGACCGACGCTGGCCCCGCGGCGAGCGAGGGCGCCGA
GCAGCCCCCGGACCTGCACTGCGTGCTGGTGACGAATCCACATTCATCTCAATGGAAGGATCCTGCCTTA
AGTCAACTTATTTGTTTTTGCCGGGAAAGTCGCTACATGGATCAATGGGTTCCAGTGATTAATCTCCCTG
AACGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204005 representing NM_001924
Red=Cloning site Green=Tags(s)

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA
LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL
SQLICFCRESRYMDQWVPVINLPER

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001924
ORF Size 495 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001924.4
RefSeq Size 1355 bp
RefSeq ORF 498 bp
Locus ID 1647
UniProt ID P24522
Cytogenetics 1p31.3
Domains Ribosomal_L7Ae
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle, MAPK signaling pathway, p53 signaling pathway
Summary This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:GADD45A (NM_001924) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204005 GADD45A (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1 10 ug
$225.00
RC204005L1 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, Myc-DDK-tagged 10 ug
$525.00
RC204005L2 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, mGFP tagged 10 ug
$525.00
RC204005L3 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, Myc-DDK-tagged 10 ug
$525.00
RC204005L4 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, mGFP tagged 10 ug
$525.00
SC118947 GADD45A (untagged)-Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.