TSSC3 (PHLDA2) (NM_003311) Human Tagged ORF Clone

SKU
RG202884
PHLDA2 (tGFP-tagged) - Human pleckstrin homology-like domain, family A, member 2 (PHLDA2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TSSC3
Synonyms BRW1C; BWR1C; HLDA2; IPL; TSSC3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202884 representing NM_003311
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAATCCCCCGACGAGGTGCTACGCGAGGGCGAGTTGGAGAAGCGCAGCGACAGCCTCTTCCAGCTAT
GGAAGAAGAAGCGCGGGGTGCTCACCTCCGACCGCCTGAGCCTGTTCCCCGCCAGCCCCCGCGCGCGCCC
CAAGGAGCTGCGCTTCCACTCCATCCTCAAGGTGGACTGCGTGGAGCGCACGGGCAAGTACGTGTACTTC
ACCATCGTCACCACCGACCACAAGGAGATCGACTTCCGCTGCGCGGGCGAGAGCTGCTGGAACGCGGCCA
TCGCGCTGGCGCTCATCGATTTCCAGAACCGCCGCGCCCTGCAGGACTTTCGCAGCCGCCAGGAACGCAC
CGCACCCGCCGCACCCGCCGAGGACGCCGTGGCTGCCGCGGCCGCCGCACCCTCCGAGCCCTCGGAGCCC
TCCAGGCCATCCCCGCAGCCCAAACCCCGCACGCCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202884 representing NM_003311
Red=Cloning site Green=Tags(s)

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF
TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP
SRPSPQPKPRTP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003311
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003311.4
RefSeq Size 937 bp
RefSeq ORF 459 bp
Locus ID 7262
UniProt ID Q53GA4
Cytogenetics 11p15.4
Protein Families Druggable Genome
Summary This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:TSSC3 (PHLDA2) (NM_003311) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202884 PHLDA2 (Myc-DDK-tagged)-Human pleckstrin homology-like domain, family A, member 2 (PHLDA2) 10 ug
$150.00
RC202884L3 Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 2 (PHLDA2), Myc-DDK-tagged 10 ug
$450.00
RC202884L4 Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 2 (PHLDA2), mGFP tagged 10 ug
$450.00
SC120954 PHLDA2 (untagged)-Human pleckstrin homology-like domain, family A, member 2 (PHLDA2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.