TSSC3 (PHLDA2) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PHLDA2 antibody: synthetic peptide directed towards the middle region of human PHLDA2. Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 17 kDa |
| Gene Name | pleckstrin homology like domain family A member 2 |
| Database Link | |
| Background | This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma |
| Synonyms | BRW1C; BWR1C; HLDA2; IPL; TSSC3 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Druggable Genome |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
The expression patterns and prognostic significance of pleckstrin homology-like domain family A (PHLDA) in lung cancer and malignant mesothelioma
Baldavira, Machado-Rugolo, Prieto et al
J Thorac Dis (2021) 13 (2), 689-707 DOI: 10.21037/jtd-20-2909
Baldavira, Machado-Rugolo, Prieto et al
J Thorac Dis (2021) 13 (2), 689-707 DOI: 10.21037/jtd-20-2909
Cited by 21
AI Summary: In this study, OriGene products, specifically the PHLDA1 (TA324328), PHLDA2 (TA324329), and PHLDA3 (TA324330) antibodies, were used for immunohistochemical analysis to assess the protein expression of PHLDA family members in lung adenocarcinoma and malignant mesothelioma tissue samples.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
