IFITM1 (NM_003641) Human Tagged ORF Clone

SKU
RG201617
IFITM1 (tGFP-tagged) - Human interferon induced transmembrane protein 1 (9-27) (IFITM1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IFITM1
Synonyms 9-27; CD225; DSPA2a; IFI17; LEU13
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201617 representing NM_003641
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAAGGAGGAACATGAGGTGGCTGTGCTGGGGGCACCCCCCAGCACCATCCTTCCAAGGTCCACCG
TGATCAACATCCACAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCTT
GAACTGGTGCTGTCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGC
GACGTGACCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCA
TCCTCATGACCATTGGATTCATCCTGTTACTGGTATTCGGCTCTGTGACAGTCTACCATATTATGTTACA
GATAATACAGGAAAAACGGGGTTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201617 representing NM_003641
Red=Cloning site Green=Tags(s)

MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003641
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003641.4
RefSeq Size 853 bp
RefSeq ORF 378 bp
Locus ID 8519
UniProt ID P13164
Cytogenetics 11p15.5
Domains CD225
Protein Families Druggable Genome, Transmembrane
Protein Pathways B cell receptor signaling pathway
Summary IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:IFITM1 (NM_003641) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201617 IFITM1 (Myc-DDK-tagged)-Human interferon induced transmembrane protein 1 (9-27) (IFITM1) 10 ug
$150.00
RC201617L1 Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), Myc-DDK-tagged 10 ug
$450.00
RC201617L2 Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), mGFP tagged 10 ug
$450.00
RC201617L3 Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), Myc-DDK-tagged 10 ug
$450.00
RC201617L4 Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), mGFP tagged 10 ug
$450.00
SC117830 IFITM1 (untagged)-Human interferon induced transmembrane protein 1 (9-27) (IFITM1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.