Cytochrome b5 Outer Mitochondrial Membrane (CYB5B) (NM_030579) Human Tagged ORF Clone

SKU
RG200604
CYB5B (tGFP-tagged) - Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cytochrome b5 Outer Mitochondrial Membrane
Synonyms CYB5-M; CYPB5M; OMB5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200604 representing NM_030579
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACTGCGGAAGCTAGCGGCAGCGATGGGAAAGGGCAGGAAGTCGAGACCTCAGTCACCTATTACC
GGTTGGAGGAGGTGGCAAAGCGCAACTCCTTGAAGGAACTGTGGCTTGTGATCCATGGGCGAGTCTACGA
TGTCACCCGCTTCCTCAACGAGCACCCTGGAGGAGAAGAGGTTCTGCTGGAACAAGCTGGTGTAGATGCA
AGTGAAAGCTTTGAAGATGTAGGACACTCTTCTGATGCCAGAGAAATGCTAAAGCAGTACTACATTGGTG
ATATCCATCCGAGTGACCTTAAACCTGAAAGTGGTAGCAAGGACCCTTCAAAAAATGATACATGCAAAAG
TTGCTGGGCATATTGGATTTTACCCATCATAGGCGCTGTTCTCTTAGGTTTCCTGTACCGCTACTACACA
TCGGAAAGCAAATCCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200604 representing NM_030579
Red=Cloning site Green=Tags(s)

MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA
SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT
SESKSS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030579
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030579.1, NP_085056.1
RefSeq Size 4286 bp
RefSeq ORF 453 bp
Locus ID 80777
UniProt ID O43169
Cytogenetics 16q22.1
Domains heme_1
Protein Families Transmembrane
Summary Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cytochrome b5 Outer Mitochondrial Membrane (CYB5B) (NM_030579) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200604 CYB5B (Myc-DDK-tagged)-Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein 10 ug
$150.00
RC200604L1 Lenti ORF clone of Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC200604L2 Lenti ORF clone of Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RC200604L3 Lenti ORF clone of Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC200604L4 Lenti ORF clone of Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC107995 CYB5B (untagged)-Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein 10 ug
$150.00
SC317248 CYB5B (untagged)-Human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.