GNG5 (NM_005274) Human Tagged ORF Clone

SKU
RG200572
GNG5 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNG5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200572 representing NM_005274
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGCTCCTCCAGCGTCGCCGCTATGAAGAAAGTGGTTCAACAGCTCCGGCTGGAGGCCGGACTCA
ACCGCGTAAAAGTTTCCCAGGCAGCTGCAGACTTGAAACAGTTCTGTCTGCAGAATGCTCAACATGACCC
TCTGCTGACTGGAGTATCTTCAAGTACAAATCCCTTCAGACCCCAGAAAGTCTGTTCCTTTTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200572 representing NM_005274
Red=Cloning site Green=Tags(s)

MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005274
ORF Size 204 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005274.3
RefSeq Size 698 bp
RefSeq ORF 207 bp
Locus ID 2787
UniProt ID P63218
Cytogenetics 1p22.3
Domains G-gamma
Protein Pathways Chemokine signaling pathway
Summary G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010]
Write Your Own Review
You're reviewing:GNG5 (NM_005274) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200572 GNG5 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5) 10 ug
$150.00
RC200572L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5), Myc-DDK-tagged 10 ug
$450.00
RC200572L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5), mGFP tagged 10 ug
$450.00
SC116833 GNG5 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 5 (GNG5) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.