SNRPF (NM_003095) Human Tagged ORF Clone

SKU
RG200416
SNRPF (tGFP-tagged) - Human small nuclear ribonucleoprotein polypeptide F (SNRPF)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SNRPF
Synonyms Sm-F; SMF; snRNP-F
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200416 representing NM_003095
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTTACCCCTCAATCCCAAACCTTTCCTCAATGGACTAACAGGAAAGCCAGTGATGGTGAAACTTA
AGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAACATGCAGCTTGCAAATAC
AGAAGAATACATAGATGGAGCTTTGTCTGGACATCTGGGTGAAGTTTTAATAAGGTGTAATAATGTCCTT
TATATCAGAGGTGTGGAAGAAGAGGAAGAAGATGGGGAAATGAGAGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200416 representing NM_003095
Red=Cloning site Green=Tags(s)

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL
YIRGVEEEEEDGEMRE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003095
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003095.3
RefSeq Size 806 bp
RefSeq ORF 261 bp
Locus ID 6636
UniProt ID P62306
Cytogenetics 12q23.1
Domains Sm
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Summary Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:23333303, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed:11991638, PubMed:28502770, PubMed:28781166, PubMed:28076346). Is also a component of the minor U12 spliceosome (PubMed:15146077). As part of the U7 snRNP it is involved in histone 3'-end processing (PubMed:12975319).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SNRPF (NM_003095) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200416 SNRPF (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptide F (SNRPF) 10 ug
$150.00
RC200416L3 Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide F (SNRPF), Myc-DDK-tagged 10 ug
$450.00
RC200416L4 Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide F (SNRPF), mGFP tagged 10 ug
$450.00
SC108475 SNRPF (untagged)-Human small nuclear ribonucleoprotein polypeptide F (SNRPF) 10 ug
$150.00
SC320607 SNRPF (untagged)-Human small nuclear ribonucleoprotein polypeptide F (SNRPF) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.