FGFR3 (NM_001163213) Human Tagged ORF Clone

SKU
RC600024
FGFR3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens fibroblast growth factor receptor 3, transcript variant 3, Signal peptide (1-22) plus EC domain (23-377)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $457.00 MSRP $457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FGFR3
Synonyms ACH; CD333; CEK2; HSFGFR3EX; JTK4
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>RC600024 representing leader sequence plus the extracellular domain region of NM_001163213
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGC
C

ATGGGCGCCCCTGCCTGCGCCCTCGCGCTCTGCGTGGCCGTGGCCATCGTGGCCGGCGCCTCCTCGGAGT
CCTTGGGGACGGAGCAGCGCGTCGTGGGGCGAGCGGCAGAAGTCCCGGGCCCAGAGCCCGGCCAGCAGGA
GCAGTTGGTCTTCGGCAGCGGGGATGCTGTGGAGCTGAGCTGTCCCCCGCCCGGGGGTGGTCCCATGGGG
CCCACTGTCTGGGTCAAGGATGGCACAGGGCTGGTGCCCTCGGAGCGTGTCCTGGTGGGGCCCCAGCGGC
TGCAGGTGCTGAATGCCTCCCACGAGGACTCCGGGGCCTACAGCTGCCGGCAGCGGCTCACGCAGCGCGT
ACTGTGCCACTTCAGTGTGCGGGTGACAGACGCTCCATCCTCGGGAGATGACGAAGACGGGGAGGACGAG
GCTGAGGACACAGGTGTGGACACAGGGGCCCCTTACTGGACACGGCCCGAGCGGATGGACAAGAAGCTGC
TGGCCGTGCCGGCCGCCAACACCGTCCGCTTCCGCTGCCCAGCCGCTGGCAACCCCACTCCCTCCATCTC
CTGGCTGAAGAACGGCAGGGAGTTCCGCGGCGAGCACCGCATTGGAGGCATCAAGCTGCGGCATCAGCAG
TGGAGCCTGGTCATGGAAAGCGTGGTGCCCTCGGACCGCGGCAACTACACCTGCGTCGTGGAGAACAAGT
TTGGCAGCATCCGGCAGACGTACACGCTGGACGTGCTGGAGCGCTCCCCGCACCGGCCCATCCTGCAGGC
GGGGCTGCCGGCCAACCAGACGGCGGTGCTGGGCAGCGACGTGGAGTTCCACTGCAAGGTGTACAGTGAC
GCACAGCCCCACATCCAGTGGCTCAAGCACGTGGAGGTGAATGGCAGCAAGGTGGGCCCGGACGGCACAC
CCTACGTTACCGTGCTCAAGTCCTGGATCAGTGAGAGTGTGGAGGCCGACGTGCGCCTCCGCCTGGCCAA
TGTGTCGGAGCGGGACGGGGGCGAGTACCTCTGTCGAGCCACCAATTTCATAGGCGTGGCCGAGAAGGCC
TTTTGGCTGAGCGTTCACGGGCCCCGAGCAGCCGAGGAGGAGCTGGTGGAGGCTGACGAGGCGGGCAGTG
TGTATGCAGGC


ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
TGGTACCGATATCAAGCTTGTCGACTCTAGA
Protein Sequence
>RC600024 representing signal peptide plus the extracellular domain region of NM_001163213
Red=Cloning sites Green= DDK and 6XHIS Tags

MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG
PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE
AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ
WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD
AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKSWISESVEADVRLRLANVSERDGGEYLCRATNFIGVAEKA
FWLSVHGPRAAEEELVEADEAGSVYAG

TRSGTRSGDYKDDDDKGSHHHHHH
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NM_001163213
ORF Size 2192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001163213.1, NP_001156685.1
RefSeq Size 4310 bp
RefSeq ORF 2427 bp
Locus ID 2261
UniProt ID P22607
Cytogenetics 4p16.3
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Bladder cancer, Endocytosis, MAPK signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton
MW 40.5 kDa
Summary This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:FGFR3 (NM_001163213) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC228586 FGFR3 (Myc-DDK-tagged)-Human fibroblast growth factor receptor 3 (FGFR3), transcript variant 3 10 ug
$1,183.00
RC228586L1 Lenti-ORF clone of FGFR3 (Myc-DDK-tagged)-Human fibroblast growth factor receptor 3 (FGFR3), transcript variant 3 10 ug
$1,483.00
RC228586L2 Lenti-ORF clone of FGFR3 (mGFP-tagged)-Human fibroblast growth factor receptor 3 (FGFR3), transcript variant 3 10 ug
$1,483.00
RC228586L3 Lenti-ORF clone of FGFR3 (Myc-DDK-tagged)-Human fibroblast growth factor receptor 3 (FGFR3), transcript variant 3 10 ug
$1,483.00
RC228586L4 Lenti-ORF clone of FGFR3 (mGFP-tagged)-Human fibroblast growth factor receptor 3 (FGFR3), transcript variant 3 10 ug
$1,483.00
RG228586 FGFR3 (tGFP-tagged) - Human fibroblast growth factor receptor 3 (FGFR3), transcript variant 3 10 ug
$1,383.00
SC327221 FGFR3 (untagged)-Human fibroblast growth factor receptor 3 (FGFR3) transcript variant 3 10 ug
$1,111.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.