Insulin Receptor R (INSRR) (NM_014215) Human Tagged ORF Clone

SKU
RC600011
INSRR (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens insulin receptor-related receptor, Signal peptide (1-26) plus EC domain (747-921)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Insulin Receptor R
Synonyms IRR
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>RC600011 representing leader sequence plus the extracellular domain region of NM_014215
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGC
C

ATGGCAGTGCCTAGTCTGTGGCCCTGGGGAGCATGCCTGCCTGTGATCTTCCTCTCCTTGGGATTTGGCC
TGGATACAGCAGCTGGGCCCCTCCGGCTGGGGGGCAACAGCTCGGATTTCGAGATCCAGGAGGACAAGGT
GCCCCGTGAGCGAGCGGTGCTGAGCGGCCTGCGCCACTTCACGGAATACCGGATCGACATCCATGCCTGC
AACCACGCGGCGCACACCGTGGGCTGCAGCGCCGCCACCTTCGTCTTTGCGCGCACCATGCCCCACAGAG
AGGCTGATGGTATTCCAGGAAAGGTGGCCTGGGAGGCCTCCAGCAAGAACAGTGTCCTTCTGCGCTGGCT
CGAGCCACCAGACCCCAACGGACTCATCCTCAAGTACGAAATCAAGTACCGCCGCTTGGGAGAGGAGGCC
ACAGTGCTGTGTGTGTCCCGTCTTCGATATGCGAAGTTTGGGGGAGTCCACCTGGCCCTGCTGCCCCCTG
GAAACTACTCTGCCAGGGTTAGGGCAACCTCACTGGCTGGCAATGGCTCTTGGACAGACAGTGTTGCCTT
CTACATCCTTGGCCCAGAGGAGGAGGATGCTGGGGGGCTGCAT


ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
TGGTACCGATATCAAGCTTGTCGACTCTAGA
Protein Sequence
>RC600011 representing signal peptide plus the extracellular domain region of NM_014215
Red=Cloning sites Green= DDK and 6XHIS Tags

MAVPSLWPWGACLPVIFLSLGFGLDTAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHFTEYRIDIHAC
NHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPPDPNGLILKYEIKYRRLGEEA
TVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGSWTDSVAFYILGPEEEDAGGLH

TRSGTRSGDYKDDDDKGSHHHHHH
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NM_014215
ORF Size 1136 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014215.2, NP_055030.1
RefSeq Size 4193 bp
RefSeq ORF 3894 bp
Locus ID 3645
UniProt ID P14616
Cytogenetics 1q23.1
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Prostate cancer, Regulation of actin cytoskeleton
MW 21.9 kDa
Summary Receptor with tyrosine-protein kinase activity. Functions as a pH sensing receptor which is activated by increased extracellular pH. Activates an intracellular signaling pathway that involves IRS1 and AKT1/PKB.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Insulin Receptor R (INSRR) (NM_014215) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224956 INSRR (Myc-DDK-tagged)-Human insulin receptor-related receptor (INSRR) 10 ug
$1,129.00
RC224956L1 Lenti ORF clone of Human insulin receptor-related receptor (INSRR), Myc-DDK-tagged 10 ug
$1,429.00
RC224956L2 Lenti ORF clone of Human insulin receptor-related receptor (INSRR), mGFP tagged 10 ug
$1,429.00
RC224956L3 Lenti ORF clone of Human insulin receptor-related receptor (INSRR), Myc-DDK-tagged 10 ug
$1,429.00
RC224956L4 Lenti ORF clone of Human insulin receptor-related receptor (INSRR), mGFP tagged 10 ug
$1,429.00
RG224956 INSRR (tGFP-tagged) - Human insulin receptor-related receptor (INSRR) 10 ug
$1,329.00
SC315340 INSRR (untagged)-Human insulin receptor-related receptor (INSRR) 10 ug
$1,243.00
SC323604 INSRR (untagged)-Kinase deficient mutant (K1013M) of Human insulin receptor-related receptor (INSRR) 10 ug
$1,130.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.