G2A (GPR132) (NM_001278696) Human Tagged ORF Clone

SKU
RC236450
GPR132 (myc-DDK-tagged) - Human G protein-coupled receptor 132 (GPR132), transcript variant 4
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol G2A
Synonyms G2A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC236450 representing NM_001278696
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCAGATGGACAGCAGGATTGCCGGGTACTACTACGCCAGGTTCACCGTTGGCTTTGCCATCCCTC
TCTCCATCATCGCCTTCACCAACCACCGGATTTTCAGGAGCATCAAGCAGAGCATGGGCTTAAGCGCTGC
CCAGAAGGCCAAGGTGAAGCACTCGGCCATCGCGGTGGTTGTCATCTTCCTAGTCTGCTTCGCCCCGTAC
CACCTGGTTCTCCTCGTCAAAGCCGCTGCCTTTTCCTACTACAGAGGAGACAGGAACGCCATGTGCGGCT
TGGAGGAAAGGCTGTACACAGCCTCTGTGGTGTTTCTGTGCCTGTCCACGGTGAACGGCGTGGCTGACCC
CATTATCTACGTGCTGGCCACGGACCATTCCCGCCAAGAAGTGTCCAGAATCCATAAGGGGTGGAAAGAG
TGGTCCATGAAGACAGACGTCACCAGGCTCACCCACAGCAGGGACACCGAGGAGCTGCAGTCGCCCGTGG
CCCTTGCAGACCACTACACCTTCTCCAGGCCCGTGCACCCACCAGGGTCACCATGCCCTGCAAAGAGGCT
GATTGAGGAGTCCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC236450 representing NM_001278696
Red=Cloning site Green=Tags(s)

MLQMDSRIAGYYYARFTVGFAIPLSIIAFTNHRIFRSIKQSMGLSAAQKAKVKHSAIAVVVIFLVCFAPY
HLVLLVKAAAFSYYRGDRNAMCGLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKE
WSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001278696
ORF Size 576 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001278696.2
RefSeq Size 2894 bp
RefSeq ORF 579 bp
Locus ID 29933
UniProt ID Q9UNW8
Cytogenetics 14q32.33
Protein Families Druggable Genome, GPCR, Transmembrane
MW 22 kDa
Summary This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein was reported to be a receptor for lysophosphatidylcholine action, but PubMedID: 15653487 retracts this finding and instead suggests this protein to be an effector of lysophosphatidylcholine action. This protein may have proton-sensing activity and may be a receptor for oxidized free fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:G2A (GPR132) (NM_001278696) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG236450 GPR132 (tGFP-tagged) - Human G protein-coupled receptor 132 (GPR132), transcript variant 4 10 ug
$530.00
SC334344 GPR132 (untagged) - Human G protein-coupled receptor 132 (GPR132), transcript variant 4 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.