Neuritin (NRN1) (NM_001278710) Human Tagged ORF Clone

SKU
RC235994
NRN1 (myc-DDK-tagged) - Human neuritin 1 (NRN1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Neuritin
Synonyms dJ380B8.2; NRN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC235994 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGACTTAAGTTGAACGGCAGATATATTTCACTGATCCTCGCGGTGCAAATAGCGTATCTGGTGCAGG
CCGTGAGAGCAGCGGGCAAGTGCGATGCGGTCTTCAAGGGCTTTTCGGACTGTTTGCTCAAGCTGGGCGA
CAGCATGGCCAACTACCCGCAGGGCCTGGACGACAAGACGAACATCAAGACCGTGTGCACATACTGGGAG
GATTTCCACAGCTGCACGGTCACAGCCCTTACGGATTGCCAGGAAGGGGCGAAAGATATGTGGGATAAAC
TGAGAAAAGAATCCAAAAACCTCAACATCCAAGGCAGCTTATTCGAACTCTGCGGCAGCGGCAACGGGGC
GGCGGGGTCCCTGCTCCCGGCGTTCCCGGTGCTCCTGGTGTCTCTCTCGGCAGCTTTAGCGACCTGGCTT
TCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC235994 protein sequence
Red=Cloning site Green=Tags(s)

MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWE
DFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGSLLPAFPVLLVSLSAALATWL
SF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001278710
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001278710.1, NP_001265639.1
RefSeq Size 1574 bp
RefSeq ORF 429 bp
Locus ID 51299
UniProt ID Q9NPD7
Cytogenetics 6p25.1
MW 15.3 kDa
Summary This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by neural activity and neurotrophins. The encoded protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins. The encoded protein promotes neurite outgrowth and arborization, suggesting its role in promoting neuritogenesis. Overexpression of the encoded protein may be associated with astrocytoma progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:Neuritin (NRN1) (NM_001278710) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG235994 NRN1 (tGFP-tagged) - Human neuritin 1 (NRN1), transcript variant 2 10 ug
$350.00
SC333888 NRN1 (untagged) - Human neuritin 1 (NRN1), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.