CHURC 1 (CHURC1) (NM_001204063) Human Tagged ORF Clone

SKU
RC231789
CHURC1 (Myc-DDK tagged) - Homo sapiens churchill domain containing 1 (CHURC1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHURC 1
Synonyms C14orf52; chch; My015
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231789 representing NM_001204063
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCAACCGTATCTCAGTTCTCGCGAGGTTTCGTCTTCCCGGAAGCGTTGGAGGACATTCCCTGTTG
ACTGCGTCGCGATGTGTGGCGACTGTGTGGAGAAGGAATATCCCAACCGGGGTAATACCTGCCTGGAGAA
TGGATCTTTCTTACTGAACTTTACAGGCTGTGCAGTGTGCAGTAAGCGGGATTTTATGCTGATCACAAAC
AAATCCTTGAAAGAAGAAGATGGAGAAGAAATAGTTACCTATGATCATTTGTGTAAGAATTGTCATCATG
TAATAGCCAGACATGAGTATACATTCAGTATCATGGATGAATTTCAGGAGTATACCATGCTGTGTCTGTT
ATGCGGCAAAGCCGAAGATACTATCAGTATTCTCCCTGATGACCCCCGACAAATGACTCTCTTATTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231789 representing NM_001204063
Red=Cloning site Green=Tags(s)

MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITN
KSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001204063
ORF Size 417 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001204063.1, NP_001190992.1
RefSeq Size 3632 bp
RefSeq ORF 420 bp
Locus ID 91612
UniProt ID Q8WUH1
Cytogenetics 14q23.3
Protein Families Transcription Factors
MW 16.6 kDa
Summary Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement (By similarity). Does not bind DNA by itself.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CHURC 1 (CHURC1) (NM_001204063) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG231789 CHURC1 (tGFP-tagged) - Homo sapiens churchill domain containing 1 (CHURC1), transcript variant 2 10 ug
$365.00
SC329689 CHURC1 (untagged) - Homo sapiens churchill domain containing 1 (CHURC1), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.