CAMTA1 (NM_001242701) Human Tagged ORF Clone

SKU
RC231628
CAMTA1 (Myc-DDK tagged) - Homo sapiens calmodulin binding transcription activator 1 (CAMTA1), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CAMTA1
Synonyms CANPMR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231628 representing NM_001242701
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGAGCGTTTCCCAAAGTGTATTCTGCG
GAACTAGCACCTACTGTGTTCTCAACACCGTGCCACCTATAGAAGATGATCATGGGAACAGCAATAGTAG
TCATGTAAAAATCTTTTTACCGAAAAAGCTGCTTGAATGTCTGCCGAAATGTTCAAGTTTACCAAAAGAG
AGGCACCGCTGGAACACTAATGAGGCTCTCACCACACACTTGTTCATGGGCGCAGCAAAGAAGAGGGATC
CACAGAGCTGGAGCCATGAGGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231628 representing NM_001242701
Red=Cloning site Green=Tags(s)

MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKE
RHRWNTNEALTTHLFMGAAKKRDPQSWSHEG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001242701
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001242701.1, NP_001229630.1
RefSeq Size 997 bp
RefSeq ORF 306 bp
Locus ID 23261
UniProt ID Q9Y6Y1
Cytogenetics 1p36.31-p36.23
Protein Families Transcription Factors
MW 11.9 kDa
Summary The protein encoded by this gene contains a CG1 DNA-binding domain, a transcription factor immunoglobulin domain, ankyrin repeats, and calmodulin-binding IQ motifs. The encoded protein is thought to be a transcription factor and may be a tumor suppressor. However, a translocation event is sometimes observed between this gene and the WWTR1 gene, with the resulting WWTR1-CAMTA1 oncoprotein leading to epithelioid hemangioendothelioma, a malignant vascular cancer. [provided by RefSeq, Mar 2017]
Write Your Own Review
You're reviewing:CAMTA1 (NM_001242701) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG231628 CAMTA1 (tGFP-tagged) - Homo sapiens calmodulin binding transcription activator 1 (CAMTA1), transcript variant 3 10 ug
$365.00
SC330004 CAMTA1 (untagged) - Homo sapiens calmodulin binding transcription activator 1 (CAMTA1), transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.