CD1E (NM_001185114) Human Tagged ORF Clone

SKU
RC231132
CD1E (Myc-DDK-tagged)-Human CD1e molecule (CD1E), transcript variant 13
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD1E
Synonyms CD1A; R2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231132 representing NM_001185114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTCCTGTTCCTCCTCTTCGAGGGTCTCTGCTGTCCTGGGGAAAATACAGCAGACCCCTTCGAGA
TCCAGATATTAGCTGGCTGTAGAATGAATGCCCCACAAATCTTCTTAAATATGGCATATCAAGGGTCAGA
TTTCCTGAGTTTCCAAGGAATTTCCTGGGAGCCATCTCCAGGAGCAGGGATCCGGGCCCAGAACATCTGT
AAAGTGCTCAATCGCTACCTAGATATTAAGGAAATACTGCAAAGCCTTCTTGGTCACACCTGCCCTCGAT
TTCTAGCGGGGCTCATGGAAGCAGGGGAGTCAGAACTGAAACGGAAAGTGAAGCCAGAGGCCTGGCTGTC
CTGTGGCCCCAGTCCTGGCCCTGGCCGTCTGCAGCTTGTGTGCCATGTCTCAGGATTCTACCCAAAGCCC
GTGTGGGTGATGTGGATGCGGGGTGAGCAGGAGCAGCGGGGCACTCAGCGAGGGGACGTCCTGCCTAATG
CTGACGAGACATGGTATCTCCGAGCAACCCTGGATGTGGCGGCTGGGGAGGCAGCTGGCCTGTCCTGTCG
GGTGAAACACAGCAGTCTAGGGGGCCATGATCTAATCATCCATTGGGGTGGATATTCCATCTTTCTCATC
CTGATCTGTTTGACTGTGATAGTTACCCTGGTCATATTGGTTGTAGTTGACTCACGGTTAAAAAAACAGA
GTTCAAATAAGAACATTCTTTCTCCCCACACACCCAGCCCTGTCTTTCTCATGGGAGCCAACACTCAGGA
CACCAAGAATTCAAGACATCAGTTCTGCTTGGCACAAGTATCGTGGATCAAAAACAGAGTATTGAAGAAG
TGGAAGACACGCCTAAACCAACTCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231132 representing NM_001185114
Red=Cloning site Green=Tags(s)

MLLLFLLFEGLCCPGENTADPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNIC
KVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKP
VWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIHWGGYSIFLI
LICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLMGANTQDTKNSRHQFCLAQVSWIKNRVLKK
WKTRLNQLW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001185114
ORF Size 867 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001185114.1, NP_001172043.1
RefSeq ORF 870 bp
Locus ID 913
UniProt ID P15812
Cytogenetics 1q23.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
MW 32.8 kDa
Summary This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:CD1E (NM_001185114) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC231132L3 Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 13, Myc-DDK-tagged 10 ug
$600.00
RC231132L4 Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 13, mGFP tagged 10 ug
$600.00
RG231132 CD1E (tGFP-tagged) - Human CD1e molecule (CD1E), transcript variant 13 10 ug
$500.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.