TLCD1 (NM_001160407) Human Tagged ORF Clone

SKU
RC228131
TLCD1 (Myc-DDK-tagged)-Human TLC domain containing 1 (TLCD1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TLCD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC228131 representing NM_001160407
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTACTCAGCAGTTCCCAAGTGCCCACCTCGCGGGCGCGGGAGGGACAGTGTATGGCAGACTCCTG
ACATGTTAGTGGAGATTGAGACGGCGTGGTCACTTTCTGGCTATTTGCTCGTTTGCTTCTCTGCGGGGTA
TTTCATCCACGATACGGTGGACATCGTGGCTAGCGGACAGACGCGAGCCTCTTGGGAATACCTTGTCCAT
CACGTCATGGCCATGGGTGCCTTCTTCTCCGGCATCTTTTGGAGCAGCTTTGTCGGTGGGGGTGTCTTAA
CACTACTGGTGGAAGTCAGCAACATCTTCCTCACCATTCGCATGATGATGAAAATCAGTAATGCCCAGGA
TCATCTCCTCTACCGGGTTAACAAGTATGTGAACCTGGTCATGTACTTTCTCTTCCGCCTGGCCCCTCAG
GCCTACCTCACCCATTTCTTCTTGCGTTATGTGAACCAGAGGACCCTGGGCACCTTCCTGCTGGGTATCC
TGCTCATGCTGGACGTGATGATCATAATCTACTTTTCCCGCCTCCTCCGCTCTGACTTCTGCCCTGAGCA
TGTCCCCAAGAAGCAACACAAAGACAAGTTCTTGACTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC228131 representing NM_001160407
Red=Cloning site Green=Tags(s)

MGYSAVPKCPPRGRGRDSVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVH
HVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQ
AYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001160407
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001160407.1, NP_001153879.1
RefSeq ORF 603 bp
Locus ID 116238
UniProt ID Q96CP7
Cytogenetics 17q11.2
Protein Families Transmembrane
MW 22.9 kDa
Summary Regulates the composition and fluidity of the plasma membrane (PubMed:30509349). Inhibits the incorporation of membrane-fluidizing phospholipids containing omega-3 long-chain polyunsaturated fatty acids (LCPUFA) and thereby promotes membrane rigidity (PubMed:30509349). Does not appear to have any effect on LCPUFA synthesis (PubMed:30509349).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TLCD1 (NM_001160407) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC228131L3 Lenti ORF clone of Human TLC domain containing 1 (TLCD1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC228131L4 Lenti ORF clone of Human TLC domain containing 1 (TLCD1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG228131 TLCD1 (tGFP-tagged) - Human TLC domain containing 1 (TLCD1), transcript variant 2 10 ug
$500.00
SC326766 TLCD1 (untagged)-Human TLC domain containing 1 (TLCD1) transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.