Xg blood group (XG) (NM_001141920) Human Tagged ORF Clone

SKU
RC227042
XG (Myc-DDK-tagged)-Human Xg blood group (XG), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Xg blood group
Synonyms PBDX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC227042 representing NM_001141920
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGCTGGTGGGGACTTCCCTGTCTTGCGTTCCTGTGTTTTCTAATGCACGCCCGAGGTCAAAGAG
ACTTTGATTTGGCAGATGCCCTTGATGACCCTGAACCCACCAAGAAGCCAAACTCAGATATCTACCCAAA
GCCAAAACCACCTTACTACCCACAGCCCGAGAATCCCGACAGCGGTGGAAATATCTACCCAAGGCCAAAG
CCACGCCCTCAACCCCAGCCTGGCAATTCCGGCAACAGTGGAGGTAGTTACTTCAATGATGTGGACCGTG
ATGACGGACGCTACCCGCCCAGGCCCAGGCCACGGCCGCCTGCAGGAGGTGGCGGCGGTGGCTACTCCAG
TTATGGCAACTCCGACAACACGCACGGTGGAGATCACCATTCAACGTATGGCAATCCAGAAGGCAATATG
GTAGCAAAAATCGTGTCTCCCATCGTATCCGTGGTGGTGGTGACACTGCTGGGAGCAGCAGCCAGTTATT
TCAAACTAAACAATAGGAGAAATTGTTTCAGGACCCATGAACCAGAAAATGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC227042 representing NM_001141920
Red=Cloning site Green=Tags(s)

MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPK
PRPQPQPGNSGNSGGSYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNM
VAKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001141920
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001141920.1, NP_001135392.1
RefSeq Size 2902 bp
RefSeq ORF 546 bp
Locus ID 7499
UniProt ID P55808
Cytogenetics Xp22.33
Protein Families Transmembrane
MW 19.8 kDa
Summary This gene encodes the XG blood group antigen, and is located at the pseudoautosomal boundary on the short (p) arm of chromosome X. The three 5' exons reside in the pseudoautosomal region and the remaining exons within the X-specific end. A truncated copy of this gene is found on the Y chromosome at the pseudoautosomal boundary. It is transcribed, but not expected to make a Y-chromosome specific gene product. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]
Write Your Own Review
You're reviewing:Xg blood group (XG) (NM_001141920) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227042L3 Lenti-ORF clone of XG (Myc-DDK-tagged)-Human Xg blood group (XG), transcript variant 3 10 ug
$630.00
RC227042L4 Lenti-ORF clone of XG (mGFP-tagged)-Human Xg blood group (XG), transcript variant 3 10 ug
$630.00
RG227042 XG (tGFP-tagged) - Human Xg blood group (XG), transcript variant 3 10 ug
$530.00
SC324765 XG (untagged)-Human Xg blood group (XG), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.