NFYC (NM_001142589) Human Tagged ORF Clone

SKU
RC226680
NFYC (Myc-DDK-tagged)-Human nuclear transcription factor Y, gamma (NFYC), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NFYC
Synonyms CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC226680 representing NM_001142589
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACAGAAGGAGGATTTGGTGGTACTAGCAGCAGTGATGCCCAGCAAAGCCTACAGTCGTTCTGGC
CTCGGGTCATGGAAGAAATCCGGAATTTAACAGTGAAAGACTTCCGAGTGCAGGAACTCCCACTGGCTCG
TATTAAGAAGATTATGAAACTGGATGAAGATGTGAAGAGAAATGATATCGCCATGGCAATTACAAAATTT
GATCAGTTTGATTTTCTCATCGATATTGTTCCAAGAGATGAACTGAAACCTCCAAAGCGTCAGGAGGAGG
TGCGCCAGTCTGTAACTCCTGCCGAGCCAGTCCAGTACTATTTCACGCTGGCTCAGCAACCCACCGCTGT
CCAAGTCCAGGGCCAGCAGCAAGGCCAGCAGACCACCAGCTCCACGACCACCATCCAGCCTGGGCAGATC
ATCATCGCACAGCCTCAGCAGGGCCAGACCACACCTGTGACAATGCAGGTTGGAGAAGGTCAGCAGGTGC
AGATTGTCCAGGCTCAGCCACAGGGTCAAGCCCAACAGGCCCAGAGTGGCACTGGACAGACCATGCAGGT
GATGCAGCAGATCATCACTAACACAGGAGAGATCCAGCAGATCCCGGTGCAGCTGAATGCCGGCCAGCTG
CAGTATATCCGCTTAGCCCAGCCTGTATCAGGCACTCAAGTTGTGCAGGGACAGATCCAGACACTTGCCA
CCAATGCTCAACAGATTACACAGACAGAGGTCCAGCAAGGACAGCAGCAGTTCAGCCAGTTCACAGATGG
ACAGCAGCTCTACCAGATCCAGCAAGTCACCATGCCTGCGGGCCAGGACCTCGCCCAGCCCATGTTCATC
CAGTCAGCCAACCAGCCCTCCGACGGGCAGGCCCCCCAGGTGACCGGCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226680 representing NM_001142589
Red=Cloning site Green=Tags(s)

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKRNDIAMAITKF
DQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQI
IIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQL
QYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFI
QSANQPSDGQAPQVTGD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001142589
ORF Size 891 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001142589.2
RefSeq ORF 894 bp
Locus ID 4802
UniProt ID Q13952
Cytogenetics 1p34.2
Protein Families Transcription Factors
Protein Pathways Antigen processing and presentation
MW 32.6 kDa
Summary This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:NFYC (NM_001142589) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC226680L3 Lenti ORF clone of Human nuclear transcription factor Y, gamma (NFYC), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC226680L4 Lenti ORF clone of Human nuclear transcription factor Y, gamma (NFYC), transcript variant 4, mGFP tagged 10 ug
$600.00
RG226680 NFYC (tGFP-tagged) - Human nuclear transcription factor Y, gamma (NFYC), transcript variant 4 10 ug
$500.00
SC325732 NFYC (untagged)-Human nuclear transcription factor Y, gamma (NFYC), transcript variant 4 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.