BEX4 (NM_001127688) Human Tagged ORF Clone

SKU
RC225057
BEX4 (Myc-DDK-tagged)-Human brain expressed, X-linked 4 (BEX4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BEX4
Synonyms BEXL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225057 representing NM_001127688
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTCCAAAGAGGAACTAGCGGCAAACAATCTCAACGGGGAAAATGCCCAACAAGAAAACGAAGGAG
GGGAGCAGGCCCCCACGCAGAATGAAGAAGAATCCCGCCATTTGGGAGGGGGTGAAGGCCAGAAGCCTGG
AGGAAATATCAGGCGGGGGCGAGTTAGGCGACTTGTCCCTAATTTTCGATGGGCCATACCTAATAGGCAT
ATTGAGCACAATGAAGCGAGAGATGATGTAGAAAGGTTTGTAGGGCAGATGATGGAAATCAAGAGAAAGA
CTAGGGAACAGCAGATGAGGCACTATATGCGCTTCCAAACTCCTGAACCTGACAACCATTATGACTTTTG
CCTCATACCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225057 representing NM_001127688
Red=Cloning site Green=Tags(s)

MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH
IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001127688
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001127688.2, NP_001121160.1
RefSeq Size 1199 bp
RefSeq ORF 363 bp
Locus ID 56271
UniProt ID Q9NWD9
Cytogenetics Xq22.1
MW 14.1 kDa
Summary This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:BEX4 (NM_001127688) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225057L3 Lenti-ORF clone of BEX4 (Myc-DDK-tagged)-Human brain expressed, X-linked 4 (BEX4) 10 ug
$450.00
RC225057L4 Lenti-ORF clone of BEX4 (mGFP-tagged)-Human brain expressed, X-linked 4 (BEX4) 10 ug
$450.00
RG225057 BEX4 (tGFP-tagged) - Human brain expressed, X-linked 4 (BEX4) 10 ug
$350.00
SC322819 BEX4 (untagged)-Human brain expressed, X-linked 4 (BEX4) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.