BEX4 Rabbit Polyclonal Antibody

SKU TA331375

Rabbit Polyclonal Anti-BEX4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BEX4 antibody is: synthetic peptide directed towards the N-terminal region of Human BEX4. Synthetic peptide located within the following region: PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 13 kDa
• Gene Name: brain expressed X-linked 4
• Database Link:
  NP_001121160
  Q9NWD9
• Background: This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Synonyms: BEXL1
• Note: Human: 100%; Horse: 92%; Rabbit: 79%

Reference Data