LCE6A (NM_001128600) Human Tagged ORF Clone

SKU
RC224998
LCE6A (Myc-DDK-tagged)-Human late cornified envelope 6A (LCE6A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LCE6A
Synonyms C1orf44
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224998 representing NM_001128600
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACAGCAGAAGCAGCAATCTTGGAAGCCTCCAAATGTTCCCAAATGCTCCCCTCCCCAAAGATCAA
ACCCCTGCCTAGCTCCCTACTCGACTCCTTGTGGTGCTCCCCATTCAGAAGGTTGTCATTCCAGTTCCCA
AAGGCCTGAGGTTCAGAAGCCTAGGAGGGCTCGTCAAAAGCTGCGCTGCCTAAGTAGGGGCACAACCTAC
CACTGCAAAGAGGAAGAGTGTGAAGGCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224998 representing NM_001128600
Red=Cloning site Green=Tags(s)

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTY
HCKEEECEGD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001128600
ORF Size 240 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001128600.2
RefSeq ORF 243 bp
Locus ID 448835
UniProt ID A0A183
Cytogenetics 1q21.3
MW 8.8 kDa
Summary Precursors of the cornified envelope of the stratum corneum.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LCE6A (NM_001128600) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224998L3 Lenti ORF clone of Human late cornified envelope 6A (LCE6A), Myc-DDK-tagged 10 ug
$450.00
RC224998L4 Lenti ORF clone of Human late cornified envelope 6A (LCE6A), mGFP tagged 10 ug
$450.00
RG224998 LCE6A (tGFP-tagged) - Human late cornified envelope 6A (LCE6A) 10 ug
$350.00
SC322797 LCE6A (untagged)-Human late cornified envelope 6A (LCE6A) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.