TMPRSS3 (NM_032401) Human Tagged ORF Clone

SKU
RC224957
TMPRSS3 (Myc-DDK-tagged)-Human transmembrane protease, serine 3 (TMPRSS3), transcript variant B
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMPRSS3
Synonyms DFNB8; DFNB8, DFNB10, ECHOS1, TADG12; DFNB10; ECHOS1; OTTHUMP00000109345; serine protease TADG12; TADG12; transmembrane protease, serine 3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224957 representing NM_032401
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCTCCGATGACTGGAAGGGTCACTACGCAAATGTTGCCTGTGCCCAACTGGGTTTCCCAAGCTATG
TGAGTTCAGATAACCTCAGAGTGAGCTCGCTGGAGGGGCAGTTCCGGGAGGAGTTTGTGTCCATCGATCA
CCTCTTGCCAGATGACAAGGTGACTGCATTACACCACTCAGTATATGTGAGGGAGGGATGTGCCTCTGGC
CACGTGGTTACCTTGCAGTGCACAGCCTGTGGTCATAGAAGGGGCTACAGCTCACGCATCGTGGGTGGAA
ACATGTCCTTGCTCTCGCAGTGGCCCTGGCAGGCCAGCCTTCAGTTCCAGGGCTACCACCTGTGCGGGGG
CTCTGTCATCACGCCCCTGTGGATCATCACTGCTGCACACTGTGTTTATGACTTGTACCTCCCCAAGTCA
TGGACCATCCAGGTGGGTCTAGTTTCCCTGTTGGACAATCCAGCCCCATCCCACTTGGTGGAGAAGATTG
TCTACCACAGCAAGTACAAGCCAAAGAGGCTGGGCAATGACATCGCCCTTATGAAGCTGGCCGGGCCACT
CACGTTCAATGAAATGATCCAGCCTGTGTGCCTGCCCAACTCTGAAGAGAACTTCCCCGATGGAAAAGTG
TGCTGGACGTCAGGATGGGGGGCCACAGAGGATGGAGCAGGTGACGCCTCCCCTGTCCTGAACCACGCGG
CCGTCCCTTTGATTTCCAACAAGATCTGCAACCACAGGGACGTGTACGGTGGCATCATCTCCCCCTCCAT
GCTCTGCGCGGGCTACCTGACGGGTGGCGTGGACAGCTGCCAGGGGGACAGCGGGGGGCCCCTGGTGTGT
CAAGAGAGGAGGCTGTGGAAGTTAGTGGGAGCGACCAGCTTTGGCATCGGCTGCGCAGAGGTGAACAAGC
CTGGGGTGTACACCCGTGTCACCTCCTTCCTGGACTGGATCCACGAGCAGATGGAGAGAGACCTAAAAAC
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224957 representing NM_032401
Red=Cloning site Green=Tags(s)

MCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASG
HVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKS
WTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKV
CWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVC
QERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032401
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032401.1, NP_115777.1
RefSeq Size 2554 bp
RefSeq ORF 983 bp
Locus ID 64699
Cytogenetics 21q22.3
Domains Tryp_SPc
Protein Families Druggable Genome, Protease, Transmembrane
MW 36.2 kDa
Summary This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, an LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor-associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:TMPRSS3 (NM_032401) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224957L3 Lenti ORF clone of Human transmembrane protease, serine 3 (TMPRSS3), transcript variant B, Myc-DDK-tagged 10 ug
$600.00
RC224957L4 Lenti ORF clone of Human transmembrane protease, serine 3 (TMPRSS3), transcript variant B, mGFP tagged 10 ug
$600.00
RG224957 TMPRSS3 (tGFP-tagged) - Human transmembrane protease, serine 3 (TMPRSS3), transcript variant B 10 ug
$500.00
SC110610 TMPRSS3 (untagged)-Human transmembrane protease, serine 3 (TMPRSS3), transcript variant B 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.