ROR1 (NM_001083592) Human Tagged ORF Clone

SKU
RC224765
ROR1 (Myc-DDK-tagged)-Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ROR1
Synonyms dJ537F10.1; NTRKR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224765 representing NM_001083592
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCGGCCGCGCCGCCGCGGGACGCGCCCGCCGCTCCTGGCGCTGCTGGCCGCGCTGCTGCTGGCCG
CACGCGGGGCTGCTGCCCAAGAAACAGAGCTGTCAGTCAGTGCTGAATTAGTGCCTACCTCATCATGGAA
CATCTCAAGTGAACTCAACAAAGATTCTTACCTGACCCTTGATGAACCAATGAATAACATCACCACGTCT
CTGGGCCAGACAGCAGAACTGCACTGCAAAGTCTCTGGGAATCCACCTCCCACCATCCGCTGGTTCAAAA
ATGATGCTCCTGTGGTCCAGGAGCCCCGGAGGCTCTCCTTTCGGTCCACCATCTATGGCTCTCGGCTGCG
GATTAGAAACCTCGACACCACAGACACAGGCTACTTCCAGTGCGTGGCAACAAACGGCAAGGAGGTGGTT
TCTTCCACTGGAGTCTTGTTTGTCAAGTTTGGCCCCCCTCCCACTGCAAGTCCAGGATACTCAGATGAGT
ATGAAGAAGATGGATTCTGTCAGCCATACAGAGGGATTGCATGTGCAAGATTTATTGGCAACCGCACCGT
CTATATGGAGTCTTTGCACATGCAAGGGGAAATAGAAAATCAGATCACAGCTGCCTTCACTATGATTGGC
ACTTCCAGTCACTTATCTGATAAGTGTTCTCAGTTCGCCATTCCTTCCCTGTGCCACTATGCCTTCCCGT
ACTGCGATGAAACTTCATCCGTCCCAAAGCCCCGTGACTTGTGTCGCGATGAATGTGAAATCCTGGAGAA
TGTCCTGTGTCAAACAGAGTACATTTTTGCAAGATCAAATCCCATGATTCTGATGAGGCTGAAACTGCCA
AACTGTGAAGATCTCCCCCAGCCAGAGAGCCCAGAAGCTGCGAACTGTATCCGGATTGGAATTCCCATGG
CAGATCCTATAAATAAAAATCACAAGTGTTATAACAGCACAGGTGTGGACTACCGGGGGACCGTCAGTGT
GACCAAATCAGGGCGCCAGTGCCAGCCATGGAATTCCCAGTATCCCCACACACACACTTTCACCGCCCTT
CGTTTCCCAGAGCTGAATGGAGGCCATTCCTACTGCCGCAACCCAGGGAATCAAAAGGAAGCTCCCTGGT
GCTTCACCTTGGATGAAAACTTTAAGTCTGATCTGTGTGACATCCCAGCGTGCGGTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224765 representing NM_001083592
Red=Cloning site Green=Tags(s)

MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS
LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV
SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG
TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP
NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL
RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001083592
ORF Size 1179 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001083592.1, NP_001077061.1
RefSeq Size 2303 bp
RefSeq ORF 1182 bp
Locus ID 4919
UniProt ID Q01973
Cytogenetics 1p31.3
Protein Families Druggable Genome, Protein Kinase, Transmembrane
MW 43.6 kDa
Summary This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:ROR1 (NM_001083592) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224765L1 Lenti ORF clone of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, Myc-DDK-tagged 10 ug
$986.00
RC224765L2 Lenti ORF clone of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, mGFP tagged 10 ug
$986.00
RC224765L3 Lenti ORF clone of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, Myc-DDK-tagged 10 ug
$986.00
RC224765L4 Lenti ORF clone of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, mGFP tagged 10 ug
$986.00
RC600059 ROR1 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens receptor tyrosine kinase-like orphan receptor 1, transcript variant 2, Signal peptide (1-29) plus EC domain (30-393) 10 ug
$686.00
RG224765 ROR1 (tGFP-tagged) - Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2 10 ug
$886.00
SC316056 ROR1 (untagged)-Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.