SOX21 (NM_007084) Human Tagged ORF Clone

SKU
RC224471
SOX21 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 21 (SOX21)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SOX21
Synonyms SOX25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224471 representing NM_007084
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAAGCCGGTGGACCACGTCAAGCGGCCCATGAACGCCTTCATGGTGTGGTCGCGGGCTCAGCGGC
GCAAGATGGCCCAGGAGAACCCCAAGATGCACAACTCGGAGATCAGCAAGCGCTTGGGCGCCGAGTGGAA
ACTGCTCACAGAGTCGGAGAAGCGGCCGTTCATCGACGAGGCCAAGCGTCTACGCGCCATGCACATGAAG
GAGCACCCCGACTACAAGTACCGGCCGCGGCGCAAGCCCAAGACGCTGCTCAAGAAGGACAAGTTCGCCT
TCCCGGTGCCCTACGGCCTGGGCGGCGTGGCGGACGCCGAGCACCCTGCGCTCAAGGCGGGCGCCGGGCT
GCACGCGGGGGCGGGCGGCGGCCTGGTGCCTGAGTCGCTGCTCGCCAATCCCGAGAAGGCGGCCGCGGCC
GCCGCCGCTGCCGCCGCACGCGTCTTCTTCCCGCAGTCGGCCGCTGCCGCCGCCGCTGCCGCCGCCGCCG
CCGCCGCGGGCAGCCCCTACTCGCTGCTCGACCTGGGCTCCAAAATGGCAGAGATCTCGTCGTCCTCGTC
CGGCCTCCCGTACGCGTCGTCGCTGGGCTACCCGACCGCGGGCGCGGGCGCCTTCCACGGCGCGGCGGCG
GCGGCTGCAGCGGCGGCCGCCGCCGCCGGGGGGCACACGCACTCGCACCCCAGCCCGGGCAACCCGGGCT
ACATGATCCCGTGCAACTGCAGCGCGTGGCCCAGCCCCGGGCTGCAGCCGCCGCTCGCCTACATCCTGCT
GCCGGGCATGGGCAAGCCCCAGCTGGACCCCTACCCCGCGGCCTACGCTGCCGCGCTA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224471 representing NM_007084
Red=Cloning site Green=Tags(s)

MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK
EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAA
AAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAA
AAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_007084
ORF Size 828 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007084.4
RefSeq Size 2537 bp
RefSeq ORF 831 bp
Locus ID 11166
UniProt ID Q9Y651
Cytogenetics 13q32.1
MW 28.4 kDa
Summary SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:SOX21 (NM_007084) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224471L1 Lenti-ORF clone of SOX21 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 21 (SOX21) 10 ug
$750.00
RC224471L2 Lenti-ORF clone of SOX21 (mGFP-tagged)-Human SRY (sex determining region Y)-box 21 (SOX21) 10 ug
$750.00
RC224471L3 Lenti-ORF clone of SOX21 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 21 (SOX21) 10 ug
$750.00
RC224471L4 Lenti-ORF clone of SOX21 (mGFP-tagged)-Human SRY (sex determining region Y)-box 21 (SOX21) 10 ug
$750.00
RG224471 SOX21 (tGFP-tagged) - Human SRY (sex determining region Y)-box 21 (SOX21) 10 ug
$650.00
SC303873 SOX21 (untagged)-Human SRY (sex determining region Y)-box 21 (SOX21) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.