Retinol dehydrogenase 16 (RDH16) (NM_003708) Human Tagged ORF Clone

SKU
RC223973
RDH16 (Myc-DDK-tagged)-Human retinol dehydrogenase 16 (all-trans) (RDH16)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Retinol dehydrogenase 16
Synonyms hRDH-E; RODH-4; SDR9C8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223973 representing NM_003708
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCTCTACCTGGCGGTTTTCGTGGGCCTGTACTACCTTCTGCACTGGTACCGGGAGAGGCAGGTGC
TGAGCCACCTGAGAGATAAGTATGTGTTCATCACGGGCTGTGACTCTGGCTTCGGGAAACTGCTGGCCAG
ACAGCTGGATGCACGAGGCTTGCGGGTGCTGGCTGCATGTCTGACGGAGAAAGGAGCCGAGCAGCTGAGG
GGCCAGACTTCAGACAGGCTGGAGACGGTGACCCTGGATGTTACCAAGACAGAGAGCGTTGCTGCAGCCG
CCCAGTGGGTGAAGGAGTGCGTGAGAGACAAAGGACTCTGGGGCCTGGTGAATAATGCTGGCATCTCCTT
GCCCACGGCTCCCAATGAGTTGCTCACCAAGCAGGACTTGCTGACCATACTGGACGTGAACTTGTTGGGG
GTGATTGATGTGACTCTGAACCTGCTGCCCTTAGTGAGGAGGGCCAGGGGCCGTGTGGTCAACGTCTTCA
GTGTCATGGGCCGGGTGTCACTTTTTGGTGGAGGCTACTGCATCTCCAAGTATGGCGTGGAAGCCTTCTC
TGACTCCCTCAGGAGGGAACTCTCCTACTTTGGGGTGAAGGTGGCTATGATTGAACCTGGCTATTTCAAG
ACTGCTGTGACCAGTAAGGAGAGATTCTTAAAGAGCTTCCTGGAGATTTGGGACCGGTCCAGTCCAGAGG
TCAAGGAGGCCTATGGCGAGAAGTTTGTTGCAGACTATAAGAAATCAGCTGAACAAATGGAGCAGAAGTG
CACACAGGATCTGTCGTTGGTGACCAACTGCATGGAGCATGCGCTGATTGCCTGCCACCCCCGTACTCGC
TACTCAGCTGGCTGGGATGCCAAGCTTCTCTACCTCCCCATGAGCTACATGCCCACCTTCCTGGTGGATG
CCATTATGTACTGGGTCTCTCCAAGCCCGGCCAAGGCTCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223973 representing NM_003708
Red=Cloning site Green=Tags(s)

MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLR
GQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDLLTILDVNLLG
VIDVTLNLLPLVRRARGRVVNVFSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFK
TAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTR
YSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003708
ORF Size 951 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003708.2, NP_003699.2
RefSeq Size 2425 bp
RefSeq ORF 954 bp
Locus ID 8608
UniProt ID O75452
Cytogenetics 12q13.3
Domains adh_short
Protein Pathways Metabolic pathways, Retinol metabolism
MW 35.5 kDa
Summary Oxidoreductase with a preference for NAD. Oxidizes all-trans-retinol, 9-cis-retinol, 11-cis-retinol and 13-cis-retinol to the corresponding aldehydes (PubMed:10329026, PubMed:12534290, PubMed:9677409). Has higher activity towards CRBP-bound retinol than with free retinol (PubMed:12534290). Oxidizes also 3-alpha-hydroxysteroids. Oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. Can also catalyze the reverse reaction (PubMed:10329026, PubMed:9677409, PubMed:29541409).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Retinol dehydrogenase 16 (RDH16) (NM_003708) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223973L1 Lenti-ORF clone of RDH16 (Myc-DDK-tagged)-Human retinol dehydrogenase 16 (all-trans) (RDH16) 10 ug
$750.00
RC223973L2 Lenti-ORF clone of RDH16 (mGFP-tagged)-Human retinol dehydrogenase 16 (all-trans) (RDH16) 10 ug
$750.00
RC223973L3 Lenti-ORF clone of RDH16 (Myc-DDK-tagged)-Human retinol dehydrogenase 16 (all-trans) (RDH16) 10 ug
$750.00
RC223973L4 Lenti-ORF clone of RDH16 (mGFP-tagged)-Human retinol dehydrogenase 16 (all-trans) (RDH16) 10 ug
$750.00
RG223973 RDH16 (tGFP-tagged) - Human retinol dehydrogenase 16 (all-trans) (RDH16) 10 ug
$650.00
SC312933 RDH16 (untagged)-Human retinol dehydrogenase 16 (all-trans) (RDH16) 10 ug
$480.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.