Doppel (PRND) (NM_012409) Human Tagged ORF Clone

SKU
RC223341
PRND (Myc-DDK-tagged)-Human prion protein 2 (dublet) (PRND)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $450.00 MSRP $450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Doppel
Synonyms dJ1068H6.4; DOPPEL; DPL; PrPLP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223341 representing NM_012409
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAAGCACCTGAGCTGGTGGTGGCTGGCCACTGTCTGCATGCTGCTCTTCAGCCACCTCTCTGCGG
TCCAGACGAGGGGCATCAAGCACAGAATCAAGTGGAACCGGAAGGCCCTGCCCAGCACTGCCCAGATCAC
TGAGGCCCAGGTGGCTGAGAACCGCCCGGGAGCCTTCATCAAGCAAGGCCGCAAGCTCGACATTGACTTC
GGAGCCGAGGGCAACAGGTACTACGAGGCCAACTACTGGCAGTTCCCCGATGGCATCCACTACAACGGCT
GCTCTGAGGCTAATGTGACCAAGGAGGCATTTGTCACCGGCTGCATCAATGCCACCCAGGCGGCGAACCA
GGGGGAGTTCCAGAAGCCAGACAACAAGCTCCACCAGCAGGTGCTCTGGCGGCTGGTCCAGGAGCTCTGC
TCCCTCAAGCATTGCGAGTTTTGGTTGGAGAGGGGCGCAGGACTTCGGGTCACCATGCACCAGCCAGTGC
TCCTCTGCCTTCTGGCTTTGATCTGGCTCACGGTGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223341 representing NM_012409
Red=Cloning site Green=Tags(s)

MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDF
GAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELC
SLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012409
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012409.4
RefSeq Size 4047 bp
RefSeq ORF 531 bp
Locus ID 23627
UniProt ID Q9UKY0
Cytogenetics 20p13
Protein Families Druggable Genome, Transmembrane
MW 20.29 kDa
Summary This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Doppel (PRND) (NM_012409) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223341L3 Lenti ORF clone of Human prion protein 2 (dublet) (PRND), Myc-DDK-tagged 10 ug
$750.00
RC223341L4 Lenti ORF clone of Human prion protein 2 (dublet) (PRND), mGFP tagged 10 ug
$750.00
RG223341 PRND (tGFP-tagged) - Human prion protein 2 (dublet) (PRND) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC303977 PRND (untagged)-Human prion protein 2 (dublet) (PRND) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.