beta Defensin 3 (DEFB103B) (NM_018661) Human Tagged ORF Clone

SKU
RC223222
DEFB103B (Myc-DDK-tagged)-Human defensin, beta 103B (DEFB103B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol beta Defensin 3
Synonyms BD-3; DEFB-3; DEFB3; DEFB103; HBD-3; HBD3; HBP-3; HBP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223222 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGATCCATTATCTTCTGTTTGCTTTGCTCTTCCTGTTTTTGGTGCCTGTTCCAGGTCATGGAGGAA
TCATAAACACATTACAGAAATATTATTGCAGAGTCAGAGGCGGCCGGTGTGCTGTGCTCAGCTGCCTTCC
AAAGGAGGAACAGATCGGCAAGTGCTCGACGCGTGGCCGAAAATGCTGCCGAAGAAAGAAA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223222 protein sequence
Red=Cloning site Green=Tags(s)

MRIHYLLFALLFLFLVPVPGHGGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_018661
ORF Size 201 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018661.4
RefSeq Size 518 bp
RefSeq ORF 204 bp
Locus ID 55894
UniProt ID P81534
Cytogenetics 8p23.1
Protein Families Secreted Protein, Transmembrane
MW 7.7 kDa
Summary Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 103, which has broad spectrum antimicrobial activity and may play an important role in innate epithelial defense. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:beta Defensin 3 (DEFB103B) (NM_018661) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223222L1 Lenti ORF clone of Human defensin, beta 103B (DEFB103B), Myc-DDK-tagged 10 ug
$450.00
RC223222L2 Lenti ORF clone of Human defensin, beta 103B (DEFB103B), mGFP tagged 10 ug
$450.00
RC223222L3 Lenti ORF clone of Human defensin, beta 103B (DEFB103B), Myc-DDK-tagged 10 ug
$450.00
RC223222L4 Lenti ORF clone of Human defensin, beta 103B (DEFB103B), mGFP tagged 10 ug
$450.00
RG223222 DEFB103B (tGFP-tagged) - Human defensin, beta 103B (DEFB103B) 10 ug
$489.00
SC304620 DEFB103B (untagged)-Human defensin, beta 103B (DEFB103B) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.