FBXO36 (NM_174899) Human Tagged ORF Clone

SKU
RC222177
FBXO36 (Myc-DDK-tagged)-Human F-box protein 36 (FBXO36)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FBXO36
Synonyms Fbx36
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222177 representing NM_174899
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCGTGGCTGCCGGAGACTCTCTTTGAAACTGTAGGACAAGGCCCGCCGCCTAGCAAAGACTATT
ACCAGTTACTGGTCACCCGGTCTCAGGTAATCTTTAGATGGTGGAAGATCTCTCTAAGGAGTGAGTATCG
ATCAACAAAACCTGGAGAAGCAAAAGAAACCCATGAAGACTTCCTAGAGAATTCACATCTTCAAGGTCAA
ACTGCCTTAATATTTGGTGCAAGAATATTAGACTATGTCATCAATTTTTGCAAAGGTAAATTTGACTTCC
TTGAACGGCTCTCAGACGATTTGCTCCTGACTATCATTTCTTATCTGGATCTTGAAGATATTGCCAGGCT
TTGTCAAACATCACACAGATTTGCAAAGCTGTGCATGTCTGATAAACTGTGGGAACAGATAGTCCAGTCG
ACCTGCGACACCATCACTCCTGACGTGAGGGCCCTGGCGGAGGACACAGGCTGGAGACAGCTGTTCTTCA
CCAACAAGCTCCAGCTCCAGCGGCAGCTCCGCAAGAGGAAACAAAAATATGGAAACCTGAGAGAAAAGCA
ACCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222177 representing NM_174899
Red=Cloning site Green=Tags(s)

MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQ
TALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQS
TCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_174899
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174899.3, NP_777559.2
RefSeq Size 924 bp
RefSeq ORF 567 bp
Locus ID 130888
UniProt ID Q8NEA4
Cytogenetics 2q36.3
Protein Families Druggable Genome
MW 21.9 kDa
Summary Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:FBXO36 (NM_174899) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222177L1 Lenti ORF clone of Human F-box protein 36 (FBXO36), Myc-DDK-tagged 10 ug
$600.00
RC222177L2 Lenti ORF clone of Human F-box protein 36 (FBXO36), mGFP tagged 10 ug
$600.00
RC222177L3 Lenti ORF clone of Human F-box protein 36 (FBXO36), Myc-DDK-tagged 10 ug
$600.00
RC222177L4 Lenti ORF clone of Human F-box protein 36 (FBXO36), mGFP tagged 10 ug
$600.00
RG222177 FBXO36 (tGFP-tagged) - Human F-box protein 36 (FBXO36) 10 ug
$500.00
SC309212 FBXO36 (untagged)-Human F-box protein 36 (FBXO36) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.