PTF1A (NM_178161) Human Tagged ORF Clone

SKU
RC221496
PTF1A (Myc-DDK-tagged)-Human pancreas specific transcription factor, 1a (PTF1A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PTF1A
Synonyms bHLHa29; p48; PACA; PAGEN2; PTF1-p48
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221496 representing NM_178161
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCGGTGTTGCTGGAGCACTTCCCCGGGGGCCTAGACGCCTTTCCTTCTTCGTACTTCGACGAGG
ACGACTTCTTCACCGACCAGTCTTCACGGGACCCCCTGGAGGACGGCGATGAGCTGCTGGCGGACGAGCA
GGCCGAGGTGGAGTTCCTTAGCCACCAGCTCCACGAGTACTGCTACCGCGACGGGGCGTGCCTGCTGCTG
CAGCCCGCGCCCCCGGCCGCCCCGCTAGCGCTCGCCCCGCCGTCCTCGGGGGGCCTCGGTGAGCCAGACG
ACGGCGGCGGCGGCGGCTACTGCTGCGAGACGGGGGCGCCCCCAGGCGGCTTCCCCTACTCGCCCGGCTC
GCCGCCCTCGTGCCTGGCCTACCCGTGCGCCGGGGCGGCAGTACTGTCTCCCGGGGCGCGGCTGCGCGGC
CTGAGCGGAGCGGCGGCTGCGGCGGCGCGGCGCCGGCGGCGGGTGCGCTCCGAGGCGGAGCTGCAGCAGC
TGCGGCAGGCGGCCAACGTGCGCGAGCGGCGGCGCATGCAGTCCATCAACGACGCCTTCGAGGGGCTGCG
CTCGCACATCCCCACGCTGCCCTACGAGAAGCGCCTCTCCAAGGTGGACACGCTGCGCCTGGCCATCGGC
TACATCAACTTCCTCAGCGAGCTCGTGCAGGCCGACCTGCCCTTGCGCGGCGGTGGCGCGGGCGGCTGCG
GGGGGCCGGGCGGCGGCGGGCGCCTGGGCGGGGACAGCCCGGGCAGCCAGGCCCAGAAGGTCATCATCTG
CCATCGGGGCACCCGGTCCCCCTCCCCCAGCGACCCTGATTATGGCCTCCCTCCCCTAGCAGGACACTCT
CTCTCATGGACTGATGAAAAACAACTCAAGGAACAAAATATTATCCGAACAGCCAAAGTCTGGACCCCAG
AGGACCCCAGAAAACTCAACAGCAAATCTTCCTTCAACAACATAGAAAACGAACCACCATTTGAGTTTGT
GTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221496 representing NM_178161
Red=Cloning site Green=Tags(s)

MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLL
QPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRG
LSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIG
YINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHS
LSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178161
ORF Size 984 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178161.3
RefSeq Size 987 bp
RefSeq ORF 987 bp
Locus ID 256297
UniProt ID Q7RTS3
Cytogenetics 10p12.2
Protein Families Embryonic stem cells, ES Cell Differentiation/IPS
MW 34.8 kDa
Summary This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PTF1A (NM_178161) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221496L1 Lenti ORF clone of Human pancreas specific transcription factor, 1a (PTF1A), Myc-DDK-tagged 10 ug
$750.00
RC221496L2 Lenti ORF clone of Human pancreas specific transcription factor, 1a (PTF1A), mGFP tagged 10 ug
$750.00
RC221496L3 Lenti ORF clone of Human pancreas specific transcription factor, 1a (PTF1A), Myc-DDK-tagged 10 ug
$750.00
RC221496L4 Lenti ORF clone of Human pancreas specific transcription factor, 1a (PTF1A), mGFP tagged 10 ug
$750.00
RG221496 PTF1A (tGFP-tagged) - Human pancreas specific transcription factor, 1a (PTF1A) 10 ug
$650.00
SC307134 PTF1A (untagged)-Human pancreas specific transcription factor, 1a (PTF1A) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.