DPRX (NM_001012728) Human Tagged ORF Clone

SKU
RC220805
DPRX (Myc-DDK-tagged)-Human divergent-paired related homeobox (DPRX)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DPRX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220805 representing NM_001012728
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGGCTCAGAGGATCTTCGTAAAGGCAAGGACCAGATGCATTCACACAGGAAACGAACCATGTTCA
CTAAGAAGCAACTGGAAGATCTGAACATCTTGTTCAATGAGAACCCATACCCAAACCCCAGCCTTCAGAA
AGAAATGGCCTCGAAAATAGACATACACCCAACAGTACTGCAGGTCTGGTTCAAGAATCACAGAGCAAAA
CTCAAGAAAGCGAAATGCAAGCATATTCATCAAAAACAAGAAACTCCACAACCGCCAATACCAGAGGGTG
GGGTCTCCACCAGTGTCGGCCTGAGAAATGCAGACACACTACCCAGATTGCCCAACGCTGCTCACCCGAT
CGGCCTGGTGTACACGGGTCATCGAGTCCCCTCATTCCAGCTCATCCTGTACCCCAACCTCAAGGTCCCT
GCAAATGACTTCATTGGCCACAGAATAGTCCATTTTGGCTGCTGCCGAGATCCTAATATATACTGCCTCT
ACCCCATTTTGGAATCCCAAGTTTGCGCTCCAAGCTTCCATTCTGGCTCTCCTGCCTGTTCATCTAACCA
AAGTCGAGAGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220805 representing NM_001012728
Red=Cloning site Green=Tags(s)

MPGSEDLRKGKDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAK
LKKAKCKHIHQKQETPQPPIPEGGVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVP
ANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSRER

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001012728
ORF Size 573 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001012728.1, NP_001012746.1
RefSeq Size 648 bp
RefSeq ORF 576 bp
Locus ID 503834
UniProt ID A6NFQ7
Cytogenetics 19q13.42
MW 21.5 kDa
Summary Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DPRX homeobox gene family. Evidence of mRNA expression has not yet been found for this gene. Multiple, related processed pseudogenes have been found which are thought to reflect expression of this gene in the germ line or embryonic cells. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DPRX (NM_001012728) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220805L3 Lenti ORF clone of Human divergent-paired related homeobox (DPRX), Myc-DDK-tagged 10 ug
$600.00
RC220805L4 Lenti ORF clone of Human divergent-paired related homeobox (DPRX), mGFP tagged 10 ug
$600.00
RG220805 DPRX (tGFP-tagged) - Human divergent-paired related homeobox (DPRX) 10 ug
$500.00
SC301711 DPRX (untagged)-Human divergent-paired related homeobox (DPRX) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.