Calcipressin 1 (RCAN1) (NM_004414) Human Tagged ORF Clone

SKU
RC220434
RCAN1 (Myc-DDK-tagged)-Human regulator of calcineurin 1 (RCAN1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Calcipressin 1
Synonyms ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220434 representing NM_004414
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAG
CGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGG
CGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCC
TGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGCCAAATTTGAGTCCCTCTTTAGGACGT
ATGACAAGGACATCACCTTTCAGTATTTTAAGAGCTTCAAACGAGTCAGAATAAACTTCAGCAACCCCTT
CTCCGCAGCAGATGCCAGGCTCCAGCTGCATAAGACTGAGTTTCTGGGAAAGGAAATGAAGTTATATTTT
GCTCAGACCTTACACATAGGAAGCTCACACCTGGCTCCGCCAAATCCAGACAAGCAGTTTCTGATCTCCC
CTCCCGCCTCTCCGCCAGTGGGATGGAAACAAGTGGAAGATGCGACCCCAGTCATAAACTATGATCTCTT
ATATGCCATCTCCAAGCTGGGGCCAGGGGAAAAGTATGAATTGCACGCAGCGACTGACACCACTCCCAGC
GTGGTGGTCCATGTATGTGAGAGTGATCAAGAGAAGGAGGAAGAAGAGGAAATGGAAAGAATGAGGAGAC
CTAAGCCAAAAATTATCCAGACCAGGAGGCCGGAGTACACGCCGATCCACCTCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220434 representing NM_004414
Red=Cloning site Green=Tags(s)

MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA
CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF
AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS
VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004414
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004414.7
RefSeq Size 2457 bp
RefSeq ORF 759 bp
Locus ID 1827
UniProt ID P53805
Cytogenetics 21q22.12
Domains Calcipressin
Protein Families Transcription Factors
MW 27.9 kDa
Summary The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
Write Your Own Review
You're reviewing:Calcipressin 1 (RCAN1) (NM_004414) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220434L1 Lenti ORF clone of Human regulator of calcineurin 1 (RCAN1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220434L2 Lenti ORF clone of Human regulator of calcineurin 1 (RCAN1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC220434L3 Lenti ORF clone of Human regulator of calcineurin 1 (RCAN1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220434L4 Lenti ORF clone of Human regulator of calcineurin 1 (RCAN1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG220434 RCAN1 (tGFP-tagged) - Human regulator of calcineurin 1 (RCAN1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117406 RCAN1 (untagged)-Human regulator of calcineurin 1 (RCAN1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.