LY108 (SLAMF6) (NM_052931) Human Tagged ORF Clone

SKU
RC220100
SLAMF6 (Myc-DDK-tagged)-Human SLAM family member 6 (SLAMF6), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LY108
Synonyms CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220100 representing NM_052931
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGTGGCTGTTCCAATCGCTCCTGTTTGTCTTCTGCTTTGGCCCAGGGAATGTAGTTTCACAAAGCA
GCTTAACCCCATTGATGGTGAACGGGATTCTGGGGGAGTCAGTAACTCTTCCCCTGGAGTTTCCTGCAGG
AGAGAAGGTCAACTTCATCACTTGGCTTTTCAATGAAACATCTCTTGCCTTCATAGTACCCCATGAAACC
AAAAGTCCAGAAATCCACGTGACTAATCCGAAACAGGGAAAGCGACTGAACTTCACCCAGTCCTACTCCC
TGCAACTCAGCAACCTGAAGATGGAAGACACAGGCTCTTACAGAGCCCAGATATCCACAAAGACCTCTGC
AAAGCTGTCCAGTTACACTCTGAGGATATTAAGACAACTGAGGAACATACAAGTTACCAATCACAGTCAG
CTATTTCAGAATATGACCTGTGAGCTCCATCTGACTTGCTCTGTGGAGGATGCAGATGACAATGTCTCAT
TCAGATGGGAGGCCTTGGGAAACACACTTTCAAGTCAGCCAAACCTCACTGTCTCCTGGGACCCCAGGAT
TTCCAGTGAACAGGACTACACCTGCATAGCAGAGAATGCTGTCAGTAATTTATCCTTCTCTGTCTCTGCC
CAGAAGCTTTGCGAAGATGTTAAAATTCAATATACAGATACCAAAATGATTCTGTTTATGGTTTCTGGGA
TATGCATAGTCTTCGGTTTCATCATACTGCTGTTACTTGTTTTGAGGAAAAGAAGAGATTCCCTATCTTT
GTCTACTCAGCGAACACAGGGCCCCGAGTCCGCAAGGAACCTAGAGTATGTTTCAGTGTCTCCAACGAAC
AACACTGTGTATGCTTCAGTCACTCATTCAAACAGGGAAACAGAAATCTGGACACCTAGAGAAAATGATA
CTATCACAATTTACTCCACAATTAATCATTCCAAAGAGAGTAAACCCACTTTTTCCAGGGCAACTGCCCT
TGACAATGTCGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220100 representing NM_052931
Red=Cloning site Green=Tags(s)

MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHET
KSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQ
LFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSA
QKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPESARNLEYVSVSPTN
NTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_052931
ORF Size 993 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_052931.5
RefSeq Size 2776 bp
RefSeq ORF 996 bp
Locus ID 114836
UniProt ID Q96DU3
Cytogenetics 1q23.2-q23.3
Domains ig, IG
Protein Families Druggable Genome, Transmembrane
MW 34.2 kDa
Summary The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:LY108 (SLAMF6) (NM_052931) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220100L1 Lenti ORF clone of Human SLAM family member 6 (SLAMF6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC220100L2 Lenti ORF clone of Human SLAM family member 6 (SLAMF6), transcript variant 2, mGFP tagged 10 ug
$600.00
RC220100L3 Lenti ORF clone of Human SLAM family member 6 (SLAMF6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC220100L4 Lenti ORF clone of Human SLAM family member 6 (SLAMF6), transcript variant 2, mGFP tagged 10 ug
$600.00
RG220100 SLAMF6 (tGFP-tagged) - Human SLAM family member 6 (SLAMF6), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108856 SLAMF6 (untagged)-Human SLAM family member 6 (SLAMF6), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.