OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LASP1 (NM_006148) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC219975
LASP1 (Myc-DDK-tagged)-Human LIM and SH3 protein 1 (LASP1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA303301 Goat Polyclonal Antibody against LASP1 (Internal Region)
100 ug
$565.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "LASP1 or NM_006148"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LASP1
Synonyms Lasp-1; MLN50
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219975 representing NM_006148
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGT
TCTGGCATAAAGCATGCTTCCATTGCGAGACCTGCAAGATGACACTGAACATGAAGAACTACAAGGGCTA
CGAGAAGAAGCCCTACTGCAACGCACACTACCCCAAGCAGTCCTTCACCATGGTGGCGGACACCCCGGAA
AACCTTCGCCTCAAGCAACAGAGTGAGCTCCAGAGTCAGGTGCGCTACAAGGAGGAGTTTGAGAAGAACA
AGGGCAAAGGTTTCAGCGTAGTGGCAGACACGCCCGAGCTCCAGAGAATCAAGAAGACCCAGGACCAGAT
CAGTAACATAAAATACCATGAGGAGTTTGAGAAGAGCCGCATGGGCCCTAGCGGGGGCGAGGGCATGGAG
CCAGAGCGTCGGGATTCACAGGACGGCAGCAGCTACCGGCGGCCCCTGGAGCAGCAGCAGCCTCACCACA
TCCCGACCAGTGCCCCGGTTTACCAGCAGCCCCAGCAGCAGCCGGTGGCCCAGTCCTATGGTGGCTACAA
GGAGCCTGCAGCCCCAGTCTCCATACAGCGCAGCGCCCCAGGTGGTGGCGGGAAGCGGTACCGCGCGGTG
TATGACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAGGACGGGGACACCATCGTCAACGTGCAGC
AGATCGACGACGGCTGGATGTACGGGACGGTGGAGCGCACCGGCGACACGGGGATGCTGCCGGCCAACTA
CGTGGAGGCCATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC219975 representing NM_006148
Red=Cloning site Green=Tags(s)

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE
NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME
PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV
YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006148
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006148.4
RefSeq Size 3846 bp
RefSeq ORF 786 bp
Locus ID 3927
UniProt ID Q14847, A0A024R1S8
Cytogenetics 17q12
Domains LIM, NEBU, SH3
Protein Families Druggable Genome
MW 29.5 kDa
Summary This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. provided by RefSeq, Oct 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006148" in other vectors (6)
SKU Description Size Price
RC219975L1 Lenti ORF clone of Human LIM and SH3 protein 1 (LASP1), Myc-DDK-tagged 10 ug
$600.00
RC219975L2 Lenti ORF clone of Human LIM and SH3 protein 1 (LASP1), mGFP tagged 10 ug
$600.00
RC219975L3 Lenti ORF clone of Human LIM and SH3 protein 1 (LASP1), Myc-DDK-tagged 10 ug
$600.00
RC219975L4 Lenti ORF clone of Human LIM and SH3 protein 1 (LASP1), mGFP tagged 10 ug
$600.00
RG219975 LASP1 (tGFP-tagged) - Human LIM and SH3 protein 1 (LASP1) 10 ug
$489.00 $500.00
SC116276 LASP1 (untagged)-Human LIM and SH3 protein 1 (LASP1) 10 ug
$300.00

Plasmid Map for RC219975

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC219975
Circular map for RC219975

file-alt Citations

Lasp1 promotes malignant phenotype of non-small-cell lung cancer via inducing phosphorylation of FAK-AKT pathway
Zhang, Liu, Fan et al
Oncotarget (2017) 8 (43), 75102-75113 DOI: 10.18632/oncotarget.20527
Snippet: …Plasmids pCMV6-ddk-myc and pCMV6-ddk-myc-Lasp1 were purchased from Origene (RC219975, Rockville, MD, USA). Lasp1-siRNA (sc;Plasmids pCMV6-ddk-myc and pCMV6-ddk-myc-Lasp1 were purchased from Origene (RC219975, Rockville, MD, USA). Lasp1-siRNA (sc-105607) and NC-siRNA (sc-37007) were purchased from Santa Cruz Biotechnology
FigureFigureFigure
Suppression of LIM and SH3 Domain Protein 1 (LASP1) Negatively Regulated by Androgen Receptor Delays Castration Resistant Prostate Cancer Progression
Dejima, Imada, Takeuchi et al
Prostate (2016)
AI Summary: OriGene’s LASP1 expressing plasmid (RC219975) was used to transiently overexpress LASP1 in prostate cancer cell lines, enabling the study of LASP1’s role in cancer progression and its regulation by the androgen receptor.
Snippet: Transient transfections of LNCaP and PC3 cells with LASP1 expressing plasmids(Origene, RC219975) were performed using Lipofectin and Lipofectamine 2000 (LifeTechnologies), respectively, according to the manufacture's protocol. ... Cite SaveSaving
Identifizierung neuer Coregulatoren von SOX9 und RUNX2 in chondrogenen Progenitorzellen in der Osteoarthrose
Cingöz
Thesis (2015)
Snippet: pCMV6-DDX5-C-Myc-DDK Kan/Neo NM_004396 OriGene (Rockville, USA) pCMV6-HSPA8-C-Myc-DDK Kan/Neo NM_006597 OriGene (Rockville, USA) pCMV6-LASP1-C-Myc-DDK Kan/Neo NM_006148 OriGene (Rockville, USA) pCMV6-RAB5C-C-Myc-DDK Kan/Neo NM_201434 OriGene (Rockville, USA) pCMV6-SFPQ-C-Myc-DDK Kan/Neo NM_005066 OriGene (Rockville, USA) pCMV6-STMN1-C-Myc-DDK Kan/Neo NM_203401 OriGene (Rockville, USA) pCMV6-YWHAE-C-Myc-DDK Kan/Neo NM_006761 OriGene (Rockville, USA)
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products