Ninjurin2 (NINJ2) (NM_016533) Human Tagged ORF Clone

SKU
RC219393
NINJ2 (Myc-DDK-tagged)-Human ninjurin 2 (NINJ2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Ninjurin2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219393 representing NM_016533
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGTCTGTCCCGCCAGCTGTGTGCTCTCTCCCACCCGAAGAAAGCAGCAGAGACTCAGACGGCGG
AGCCTGGAGGAGCCCACGCAGTCTGTTCCCGGCACCCGGTGCGTGTGAAGGGACTTGAGGGCAGCGAGAT
GGAATCAGCAAGAGAAAACATCGACCTTCAACCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTG
AACCATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCA
TGCGGCTGAAGGCGGTGCTGGAGCAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAG
CCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTGGTCATTGCACGGCTGAACCTGAATGAG
GTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACTGTGGTCA
TCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCC
TCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219393 representing NM_016533
Red=Cloning site Green=Tags(s)

MAGLSRQLCALSHPKKAAETQTAEPGGAHAVCSRHPVRVKGLEGSEMESARENIDLQPGSSDPRSQPINL
NHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSSHYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNE
VEKQWRLNQLNNAATILVFFTVVINVFITAFGAHKTGFLAARASRNPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016533
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016533.5, NP_057617.2
RefSeq Size 1073 bp
RefSeq ORF 429 bp
Locus ID 4815
UniProt ID Q9NZG7
Cytogenetics 12p13.33
Protein Families Transmembrane
MW 20.2 kDa
Summary The protein encoded by this gene belongs to the ninjurin (for nerve injury induced) family. It is a cell surface adhesion protein that is upregulated in Schwann cells surrounding the distal segment of injured nerve, and promotes neurite outgrowth, thus may have a role in nerve regeneration after nerve injury. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:Ninjurin2 (NINJ2) (NM_016533) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219393L1 Lenti ORF clone of Human ninjurin 2 (NINJ2), Myc-DDK-tagged 10 ug
$600.00
RC219393L2 Lenti ORF clone of Human ninjurin 2 (NINJ2), mGFP tagged 10 ug
$600.00
RC219393L3 Lenti ORF clone of Human ninjurin 2 (NINJ2), Myc-DDK-tagged 10 ug
$600.00
RC219393L4 Lenti ORF clone of Human ninjurin 2 (NINJ2), mGFP tagged 10 ug
$600.00
RG219393 NINJ2 (tGFP-tagged) - Human ninjurin 2 (NINJ2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC304430 NINJ2 (untagged)-Human ninjurin 2 (NINJ2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.