CCDC46 (CEP112) (NM_001037325) Human Tagged ORF Clone

SKU
RC219337
CEP112 (Myc-DDK-tagged)-Human centrosomal protein 112kDa (CEP112), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCDC46
Synonyms CCDC46; MACOCO; SPGF44
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219337 representing NM_001037325
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGCTTCTCTGAGTTTAGACCATCCATCTGCCAAGGAAAACCAAGCCCTGAGACTGATAGAGATGA
GAGAAGAGAATGGTAATGTCCCCAAGACAGAGCAGGCAGGAAGTTTGAAGCCTCTGAGGGATACAGGAAA
ATCTAACCTCAAAGAGAAGAAGGCCAACAGCAAGCTGAAGCAGATTGAGAAGGAATACACTCAGAAGCTT
GCCAAATCTTCACAGATCATAGCAGAACTTCAGACAACCATTTCCTCTCTGAAAGAAGAGAACAGCCAGC
AGCAGCTTGCTGCAGAAAGGCGGCTCCAGGATGTTAGACAAAAGTTTGAAGATGAGAAGAAGCAGCTGAT
TAGAGATAATGACCAAGCAATCAAGGTTTTACAAGATGAATTAGAAAACCGTTCTAATCAGGTGCGATGT
GCAGAGAAAAAATTACAACACAAAGAATTGGAGTCACAGGAACAGATAACTTACATACGACAAGAATATG
AAACAAAATTGAAAGGATTGATGCCAGCATCCCTAAGACAAGAACTTGAAGACACCATTTCCTCCCTAAA
ATCACAGGTTAATTTTCTGCAAAAGAGAGCTTCCATCCTTCAGGAAGAACTGACTACATATCAAGGCAGA
AGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219337 representing NM_001037325
Red=Cloning site Green=Tags(s)

MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKL
AKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRC
AEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGR
R

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001037325
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001037325.3
RefSeq Size 1258 bp
RefSeq ORF 636 bp
Locus ID 201134
UniProt ID Q8N8E3
Cytogenetics 17q24.1
MW 24.4 kDa
Summary This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:CCDC46 (CEP112) (NM_001037325) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219337L3 Lenti ORF clone of Human centrosomal protein 112kDa (CEP112), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC219337L4 Lenti ORF clone of Human centrosomal protein 112kDa (CEP112), transcript variant 2, mGFP tagged 10 ug
$600.00
RG219337 CEP112 (tGFP-tagged) - Human centrosomal protein 112kDa (CEP112), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC302884 CEP112 (untagged)-Human centrosomal protein 112kDa (CEP112), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.