PPIL5 (LRR1) (NM_203467) Human Tagged ORF Clone

SKU
RC219090
LRR1 (Myc-DDK-tagged)-Human leucine rich repeat protein 1 (LRR1), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPIL5
Synonyms 4-1BBLRR; LRR-1; PPIL5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219090 representing NM_203467
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTACACTGTGAGGTGGAGGTGATCAGCCGGCACTTGCCCGCCTTGGGGCTTAGGAACCGGGGCA
AGGGCGTCCGAGCCGTGTTGAGCCTCTGTCAGCAGACTTCCAGGAGTCAGCCGCCGGTCCGAGCCTTCCT
GCTCATCTCCACCCTGAAGGACAAGCGCGGGACCCGCTATGAGCTAAGGGAGAACATTGAGCAATTCTTC
ACCAAATTTGTAGATGAGGGGAAAGCCACTGTTCGGTTAAAGGAGCCTCCTGTGGATATCTGTCTAAGTA
AGGATTCCATATGGCTCTCATATCATTCCATTCCATCTCTGCCAAGATTTGGATACCGCAAAAATTTGTG
TTTGTGGAAGATTCTGTCTGAACTCTTTCATTCAAGGAACTACTACCATGAATCTGCATTCTGTTGCCCA
CACTGTGGTCTTAGTAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219090 representing NM_203467
Red=Cloning site Green=Tags(s)

MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRYELRENIEQFF
TKFVDEGKATVRLKEPPVDICLSKDSIWLSYHSIPSLPRFGYRKNLCLWKILSELFHSRNYYHESAFCCP
HCGLSR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_203467
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_203467.1, NP_982292.1
RefSeq Size 1049 bp
RefSeq ORF 441 bp
Locus ID 122769
UniProt ID Q96L50
Cytogenetics 14q21.3
Protein Families Druggable Genome
MW 16.8 kDa
Summary The protein encoded by this gene contains a leucine-rich repeat (LRR). It specifically interacts with TNFRSF9/4-1BB, a member of the tumor necrosis factor receptor (TNFR) superfamily. Overexpression of this gene suppresses the activation of NF-kappa B induced by TNFRSF9 or TNF receptor-associated factor 2 (TRAF2), which suggests that this protein is a negative regulator of TNFRSF9-mediated signaling cascades. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:PPIL5 (LRR1) (NM_203467) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219090L3 Lenti ORF clone of Human leucine rich repeat protein 1 (LRR1), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC219090L4 Lenti ORF clone of Human leucine rich repeat protein 1 (LRR1), transcript variant 3, mGFP tagged 10 ug
$450.00
RG219090 LRR1 (tGFP-tagged) - Human leucine rich repeat protein 1 (LRR1), transcript variant 3 10 ug
$350.00
SC308198 LRR1 (untagged)-Human leucine rich repeat protein 1 (LRR1), transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.