C11orf85 (MAJIN) (NM_001037225) Human Tagged ORF Clone

SKU
RC219046
C11orf85 (Myc-DDK-tagged)-Human chromosome 11 open reading frame 85 (C11orf85)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C11orf85
Synonyms C11orf85
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219046 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTTAAAACCCTTTACCTACCCGTTTCCAGAGACGAGGTTTCTTCATGCAGGACCCAATGTGTATA
AATTCAAAATCAGATATGGGAAGAGTATCAGAGGAGAAGAGATAGAAAATAAGGAAGTCATCACCCAGGA
GCTGGAGGATTCTGTCCGCGTGGTCTTGGGAAACTTGGACAATCTTCAGCCCTTTGCTACAGAACACTTC
ATTGTATTTCCCTATAAAAGCAAATGGGAGAGAGTTTCCCACCTGAAATTCAAACATGGGGAAATTATCT
TGATCCCCTACCCATTTGTTTTTACTCTATATGTGGAGATGAAATGGTTCCATGAAAACCTGTCACCTGG
GAAACCAATAAGTGACAGTCCTCTTGGGTTGGTCCCAGTTGAGAAGAAAGCAGTAGGAGCTGTGATGAGG
AAACGAAAACACATGGACGAGCCCAGCTCCCCCAGCAGGCCAGGGCTGGACAGAATAGGGAAAGAAAAAC
CCAACAAGGATTGCAGGAGACTCTGGCCTCTGATATCACTGATGTCCAGAAACAAGATTCTGAGTGGGGA
CACAGCCTGCCAGGGCGAATTGTCCCACCCCTGCAGCACAACTCACCTCCACCTAAGGAGCGAGCAGCCA
CCGGCTTCTTTGGGTTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219046 protein sequence
Red=Cloning site Green=Tags(s)

MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHF
IVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHENLSPGKPISDSPLGLVPVEKKAVGAVMR
KRKHMDEPSSPSRPGLDRIGKEKPNKDCRRLWPLISLMSRNKILSGDTACQGELSHPCSTTHLHLRSEQP
PASLGF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001037225
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001037225.3
RefSeq Size 1291 bp
RefSeq ORF 651 bp
Locus ID 283129
UniProt ID Q3KP22
Cytogenetics 11q13.1
MW 24.8 kDa
Summary Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C11orf85 (MAJIN) (NM_001037225) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219046L3 Lenti ORF clone of Human chromosome 11 open reading frame 85 (C11orf85), Myc-DDK-tagged 10 ug
$600.00
RC219046L4 Lenti ORF clone of Human chromosome 11 open reading frame 85 (C11orf85), mGFP tagged 10 ug
$600.00
RG219046 C11orf85 (tGFP-tagged) - Human chromosome 11 open reading frame 85 (C11orf85) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC302866 C11orf85 (untagged)-Human chromosome 11 open reading frame 85 (C11orf85) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.