MAGEA5 (NM_021049) Human Tagged ORF Clone
SKU
RC218575
MAGEA5 (Myc-DDK-tagged)-Human melanoma antigen family A, 5 (MAGEA5)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | MAGEA5 |
Synonyms | CT1.5; MAGE5; MAGEA4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC218575 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTCTTGAGCAGAAGAGTCAGCACTGCAAGCCTGAGGAAGGCCTTGACACCCAAGAAGAGGCCCTGG GCCTGGTGGGTGTGCAGGCTGCCACTACTGAGGAGCAGGAGGCTGTGTCCTCCTCCTCTCCTCTGGTCCC AGGCACCCTGGGGGAGGTGCCTGCTGCTGGGTCACCAGGTCCTCTCAAGAGTCCTCAGGGAGCCTCCGCC ATCCCCACTGCCATCGATTTCACTCTATGGAGGCAATCCATTAAGGGCTCCAGCAACCAAGAAGAGGAGG GGCCAAGCACCTCCCCTGACCCAGAGTCTGTGTTCCGAGCAGCACTCAGTAAGAAGGTGGCTGACTTGAT TCATTTTCTGCTCCTCAAGTAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218575 protein sequence
Red=Cloning site Green=Tags(s) MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASA IPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_021049 |
ORF Size | 372 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_021049.4 |
RefSeq Size | 1664 bp |
RefSeq ORF | 375 bp |
Locus ID | 4104 |
UniProt ID | P43359 |
Cytogenetics | Xq28 |
MW | 13 kDa |
Summary | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene is interpreted to be a pseudogene. Read-through transcription exists between this gene and the upstream melanoma antigen family A, 10 (MAGEA10) gene. [provided by RefSeq, Dec 2020] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC218575L3 | Lenti ORF clone of Human melanoma antigen family A, 5 (MAGEA5), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC218575L4 | Lenti ORF clone of Human melanoma antigen family A, 5 (MAGEA5), mGFP tagged | 10 ug |
$450.00
|
|
RG218575 | MAGEA5 (tGFP-tagged) - Human melanoma antigen family A, 5 (MAGEA5) | 10 ug |
$489.00
|
|
SC304898 | MAGEA5 (untagged)-Human melanoma antigen family A, 5 (MAGEA5) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.