mu Crystallin (CRYM) (NM_001888) Human Tagged ORF Clone

SKU
RC218123
CRYM (Myc-DDK-tagged)-Human crystallin, mu (CRYM), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol mu Crystallin
Synonyms DFNA40; THBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218123 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGGGTACCAGCGTTCCTGAGCGCGGCCGAGGTGGAGGAACACCTCCGCAGCTCCAGCCTCCTCA
TCCCGCCTCTAGAGACGGCCCTGGCCAACTTCTCCAGCGGTCCCGAAGGAGGGGTCATGCAGCCCGTGCG
CACCGTGGTGCCGGTGACCAAGCACAGGGGCTACCTGGGGGTCATGCCCGCCTACAGTGCTGCAGAGGAT
GCACTGACCACCAAGTTGGTCACCTTCTACGAGGACCGCGGCATCACCTCGGTCGTCCCTTCCCACCAGG
CTACTGTGCTACTCTTTGAGCCCAGCAATGGCACCCTGCTGGCGGTCATGGATGGAAATGTCATAACTGC
AAAGAGAACAGCTGCAGTTTCTGCCATTGCCACCAAGTTTCTGAAACCTCCCAGCAGTGAAGTGCTGTGC
ATCCTTGGGGCTGGGGTCCAGGCCTACAGCCATTATGAGATCTTCACAGAGCAGTTCTCCTTTAAGGAGG
TGAGGATATGGAACCGCACCAAAGAAAATGCAGAGAAGTTTGCAGACACAGTGCAAGGAGAGGTACGGGT
CTGTTCTTCGGTCCAGGAGGCTGTGGCAGGTGCAGATGTGATCATCACAGTCACCCTGGCAACAGAGCCC
ATTTTGTTTGGTGAATGGGTGAAGCCAGGGGCTCACATCAATGCTGTTGGAGCCAGCAGACCTGACTGGA
GAGAACTGGATGATGAGCTCATGAAAGAAGCTGTGCTGTACGTGGATTCCCAGGAGGCTGCCCTGAAGGA
GTCTGGAGATGTCCTGCTGTCAGGGGCCGAGATCTTTGCTGAGCTGGGAGAAGTGATTAAGGGAGTGAAA
CCAGCCCACTGTGAGAAGACCACGGTGTTCAAGTCTTTGGGAATGGCAGTGGAAGACACAGTTGCAGCCA
AACTCATCTATGATTCCTGGTCATCTGGTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218123 protein sequence
Red=Cloning site Green=Tags(s)

MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAED
ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLC
ILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEP
ILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVK
PAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001888
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001888.1
RefSeq Size 1559 bp
RefSeq ORF 945 bp
Locus ID 1428
UniProt ID Q14894
Cytogenetics 16p12.2
Domains ODC_Mu_crystall
MW 33.8 kDa
Summary Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:mu Crystallin (CRYM) (NM_001888) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218123L1 Lenti ORF clone of Human crystallin, mu (CRYM), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC218123L2 Lenti ORF clone of Human crystallin, mu (CRYM), transcript variant 1, mGFP tagged 10 ug
$600.00
RC218123L3 Lenti ORF clone of Human crystallin, mu (CRYM), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC218123L4 Lenti ORF clone of Human crystallin, mu (CRYM), transcript variant 1, mGFP tagged 10 ug
$600.00
RG218123 CRYM (tGFP-tagged) - Human crystallin, mu (CRYM), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118966 CRYM (untagged)-Human crystallin, mu (CRYM), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.