NSMCE1 (NM_145080) Human Tagged ORF Clone

SKU
RC218073
NSMCE1 (Myc-DDK-tagged)-Human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NSMCE1
Synonyms NSE1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218073 representing NM_145080
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGGCAGCACAAGGAGAATGGGCGTCATGACTGATGTCCACCGGCGCTTCCTCCAGTTGCTGATGA
CCCATGGCGTGCTAGAGGAATGGGACGTGAAGCGCTTGCAGACGCACTGCTACAAGGTCCATGACCGCAA
TGCCACCGTAGATAAGTTGGAGGACTTCATCAACAACATTAACAGTGTCTTGGAGTCCTTGTATATTGAG
ATAAAGAGAGGAGTCACGGAAGATGATGGGAGACCCATTTATGCGTTGGTGAATCTTGCTACAACTTCAA
TTTCCAAAATGGCTACGGATTTTGCAGAGAATGAACTGGATTTGTTTAGAAAGGCTCTGGAACTGATTAT
TGACTCAGAAACCGGCTTTGCGTCTTCCACAAACATATTGAACCTGGTTGATCAACTTAAAGGCAAGAAG
ATGAGGAAGAAGGAAGCGGAGCAGGTGCTGCAGAAGTTTGTTCAAAACAAGTGGCTGATTGAGAAGGAAG
GGGAGTTCACCCTGCACGGCCGGGCCATCCTGGAGATGGAACAATACATCCGGGAGACGTACCCCGACGC
GGTGAAGATCTGCAATATCTGTCACAGCCTCCTCATCCAGGGTCAAAGCTGCGAAACCTGTGGGATCAGG
ATGCACTTACCCTGCGTGGCCAAGTACTTCCAGTCGAATGCTGAACCGCGCTGCCCCCACTGCAACGACT
ACTGGCCCCACGAGATCCCAAAAGTCTTCGACCCTGAGAAGGAGAGGGAGTCTGGTGTCTTGAAATCGAA
CAAAAAGTCCCTGCGGTCCAGGCAGCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218073 representing NM_145080
Red=Cloning site Green=Tags(s)

MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIE
IKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKK
MRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIR
MHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145080
ORF Size 798 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145080.3, NP_659547.2
RefSeq Size 1079 bp
RefSeq ORF 801 bp
Locus ID 197370
UniProt ID Q8WV22
Cytogenetics 16p12.1
Protein Families Druggable Genome
MW 30.7 kDa
Summary RING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair (PubMed:29225034, PubMed:20864041). NSMCE3/MAGEG1 and NSMCE1 ubiquitin ligase are components of SMC5-SMC6 complex and may positively regulate homologous recombination-mediated DNA repair (PubMed:18086888). MAGEF1-NSMCE1 ubiquitin ligase promotes proteasomal degradation of MMS19, a key component of the cytosolic iron-sulfur protein assembly (CIA) machinery. Down-regulation of MMS19 impairs the activity of several DNA repair and metabolism enzymes such as ERCC2/XPD, FANCJ, RTEL1 and POLD1 that require iron-sulfur clusters as cofactors (PubMed:29225034).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NSMCE1 (NM_145080) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218073L3 Lenti ORF clone of Human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1), Myc-DDK-tagged 10 ug
$600.00
RC218073L4 Lenti ORF clone of Human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1), mGFP tagged 10 ug
$600.00
RG218073 NSMCE1 (tGFP-tagged) - Human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC100078 NSMCE1 (untagged)-Human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1) 10 ug
$300.00
SC317383 NSMCE1 (untagged)-Human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.