Cadherin like 26 (CDH26) (NM_021810) Human Tagged ORF Clone

SKU
RC217161
CDH26 (Myc-DDK-tagged)-Human cadherin 26 (CDH26), transcript variant b
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cadherin like 26
Synonyms VR20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217161 representing NM_021810
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACCTCTGATATGGACATGGTCAGATGTTGAAGGCCAGAGGCCGGCTCTGCTCATCTGCACAGCTG
CAGCAGGACCCACGCAGGGAGTTAAGGATCTCGAGGAAGTGCCTCCATCTGCAGCGAGTCAGTCAGCCCA
AGCACGCTGTGCTCTGGGGAGCTGGGGTTATGGCAAGCCCTTTGAGCCAAGAAGTGTGAAAAACATACAC
TCTACTCCTGCTTACCCAGATGCCACAATGCACAGACAACTCCTGGCTCCGGTGGAAGGAAGGATGGCAG
AGACATTGAATCAGAAACTCCATGTTGCCAATGTGCTGGAAGATGACCCCGGCTACCTACCTCACGTCTA
CAGCGAGGAAGGGGAGTGTGGAGGGGCCCCATCCCTCAGCTCTCTGGCCAGCTTGGAACAGGAGTTGCAA
CCTGATTTGCTGGACTCTTTGGGTTCAAAAGCGACTCCGTTTGAGGAAATATATTCAGAGTCAGGTGTTC
CTTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217161 representing NM_021810
Red=Cloning site Green=Tags(s)

MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIH
STPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQ
PDLLDSLGSKATPFEEIYSESGVPS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021810
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021810.6
RefSeq Size 1090 bp
RefSeq ORF 498 bp
Locus ID 60437
UniProt ID Q8IXH8
Cytogenetics 20q13.33
Protein Families Transmembrane
MW 17.7 kDa
Summary This gene encodes a member of the cadherin protein family. Cadherins are a family of calcium-dependent adhesion molecules that mediate cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization, migration and differentiation. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. This protein is expressed in gastrointestinal epithelial cells and may be upregulated during allergic inflammation. This protein interacts with alpha integrins and may also be involved in leukocyte migration and adhesion. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:Cadherin like 26 (CDH26) (NM_021810) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217161L3 Lenti-ORF clone of CDH26 (Myc-DDK-tagged)-Human cadherin 26 (CDH26), transcript variant b 10 ug
$465.00
RC217161L4 Lenti-ORF clone of CDH26 (mGFP-tagged)-Human cadherin 26 (CDH26), transcript variant b 10 ug
$465.00
RG217161 CDH26 (tGFP-tagged) - Human cadherin 26 (CDH26), transcript variant b 10 ug
$365.00
SC304960 CDH26 (untagged)-Human cadherin 26 (CDH26), transcript variant b 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.