Ovary specific acidic protein (MGARP) (NM_032623) Human Tagged ORF Clone

SKU
RC216908
MGARP (Myc-DDK-tagged)-Human chromosome 4 open reading frame 49 (C4orf49)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Ovary specific acidic protein
Synonyms C4orf49; CESP-1; HUMMR; OSAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216908 representing NM_032623
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATCTCCGCAGGGCGGTCTCCAAGACTCTGGCGCTGCCGCTGAGGGCGCCCCCCAACCCCGCGCCGC
TCGGAAAGGACGCATCTCTGCGCCGGATGTCATCTAACAGATTCCCTGGATCATCTGGATCAAATATGAT
TTATTATCTGGTTGTAGGCGTCACAGTCAGTGCTGGTGGATATTATGCTTACAAGACAGTCACATCAGAC
CAAGCCAAACACACAGAACATAAAACAAATTTGAAAGAAAAAACAAAAGCAGAGATACATCCATTTCAAG
GTGAAAAGGAGAATGTTGCGGAAACTGAGAAAGCAAGTTCAGAAGCCCCAGAAGAACTTATAGTGGAAGC
TGAGGTGGTAGATGCTGAAGAAAGTCCCAGTGCTACAGTTGTGGTCATAAAAGAGGCATCTGCCTGTCCA
GGTCACGTGGAGGCTGCTCCGGAGACCACAGCAGTCAGTGCTGAAACCGGGCCAGAGGTCACAGATGCAG
CGGCGAGGGAAACCACGGAAGTAAACCCTGAAACAACCCCAGAGGTTACAAATGCTGCCCTGGATGAAGC
TGTCACCATCGATAATGATAAAGATACAACAAAGAACGAAACCTCTGATGAATATGCTGAACTAGAAGAA
GAAAATTCTCCAGCTGAGTCAGAGTCCTCTGCTGGAGATGATTTACAGGAGGAAGCCAGTGTTGGCTCTG
AGGCTGCTTCGGCTCAAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216908 representing NM_032623
Red=Cloning site Green=Tags(s)

MYLRRAVSKTLALPLRAPPNPAPLGKDASLRRMSSNRFPGSSGSNMIYYLVVGVTVSAGGYYAYKTVTSD
QAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACP
GHVEAAPETTAVSAETGPEVTDAAARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEE
ENSPAESESSAGDDLQEEASVGSEAASAQG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032623
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032623.4
RefSeq Size 1219 bp
RefSeq ORF 723 bp
Locus ID 84709
UniProt ID Q8TDB4
Cytogenetics 4q31.1
Protein Families Transmembrane
MW 25.2 kDa
Summary Plays a role in the trafficking of mitochondria along microtubules. Regulates the kinesin-mediated axonal transport of mitochondria to nerve terminals along microtubules during hypoxia. Participates in the translocation of TRAK2/GRIF1 from the cytoplasm to the mitochondrion. Also plays a role in steroidogenesis through maintenance of mitochondrial abundance and morphology (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ovary specific acidic protein (MGARP) (NM_032623) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216908L1 Lenti-ORF clone of MGARP (Myc-DDK-tagged)-Human chromosome 4 open reading frame 49 (C4orf49) 10 ug
$600.00
RC216908L2 Lenti-ORF clone of MGARP (mGFP-tagged)-Human chromosome 4 open reading frame 49 (C4orf49) 10 ug
$600.00
RC216908L3 Lenti-ORF clone of MGARP (Myc-DDK-tagged)-Human chromosome 4 open reading frame 49 (C4orf49) 10 ug
$600.00
RC216908L4 Lenti-ORF clone of MGARP (mGFP-tagged)-Human chromosome 4 open reading frame 49 (C4orf49) 10 ug
$600.00
RG216908 MGARP (tGFP-tagged) - Human chromosome 4 open reading frame 49 (C4orf49) 10 ug
$500.00
SC305491 MGARP (untagged)-Human chromosome 4 open reading frame 49 (C4orf49) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.