Luteinizing Hormone beta (LHB) (NM_000894) Human Tagged ORF Clone
SKU
RC216028
LHB (Myc-DDK-tagged)-Human luteinizing hormone beta polypeptide (LHB)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Luteinizing Hormone beta |
Synonyms | CGB4; HH23; LSH-B; LSH-beta |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC216028 representing NM_000894
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGATGCTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGGCATGGGCATCCAGGGAGC CGCTTCGGCCATGGTGCCACCCCATCAATGCCATCCTGGCTGTCGAGAAGGAGGGCTGCCCAGTGTGCAT CACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGATGCGCGTGCTGCAGGCGGTCCTGCCG CCCCTGCCTCAGGTGGTGTGCACCTACCGTGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGC GTGGTGTGGACCCCGTGGTCTCCTTCCCTGTGGCTCTCAGCTGTCGCTGTGGACCCTGCCGCCGCAGCAC CTCTGACTGTGGGGGTCCCAAAGACCACCCCTTGACCTGTGACCACCCCCAACTCTCAGGCCTCCTCTTC CTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC216028 representing NM_000894
Red=Cloning site Green=Tags(s) MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF L myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000894 |
ORF Size | 423 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_000894.3 |
RefSeq Size | 523 bp |
RefSeq ORF | 426 bp |
Locus ID | 3972 |
UniProt ID | P01229 |
Cytogenetics | 19q13.33 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | GnRH signaling pathway, Neuroactive ligand-receptor interaction |
MW | 15.35 kDa |
Summary | This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC216028L1 | Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC216028L2 | Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), mGFP tagged | 10 ug |
$450.00
|
|
RC216028L3 | Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC216028L4 | Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), mGFP tagged | 10 ug |
$450.00
|
|
RG216028 | LHB (tGFP-tagged) - Human luteinizing hormone beta polypeptide (LHB) | 10 ug |
$350.00
|
|
SC300146 | LHB (untagged)-Human luteinizing hormone beta polypeptide (LHB) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.