Luteinizing Hormone beta (LHB) (NM_000894) Human Tagged ORF Clone

SKU
RG216028
LHB (tGFP-tagged) - Human luteinizing hormone beta polypeptide (LHB)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Luteinizing Hormone beta
Synonyms CGB4; HH23; LSH-B; LSH-beta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG216028 representing NM_000894
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGATGCTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGGCATGGGCATCCAGGGAGC
CGCTTCGGCCATGGTGCCACCCCATCAATGCCATCCTGGCTGTCGAGAAGGAGGGCTGCCCAGTGTGCAT
CACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGATGCGCGTGCTGCAGGCGGTCCTGCCG
CCCCTGCCTCAGGTGGTGTGCACCTACCGTGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGC
GTGGTGTGGACCCCGTGGTCTCCTTCCCTGTGGCTCTCAGCTGTCGCTGTGGACCCTGCCGCCGCAGCAC
CTCTGACTGTGGGGGTCCCAAAGACCACCCCTTGACCTGTGACCACCCCCAACTCTCAGGCCTCCTCTTC
CTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216028 representing NM_000894
Red=Cloning site Green=Tags(s)

MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP
PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF
L

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000894
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000894.3
RefSeq Size 523 bp
RefSeq ORF 426 bp
Locus ID 3972
UniProt ID P01229
Cytogenetics 19q13.33
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway, Neuroactive ligand-receptor interaction
Summary This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Luteinizing Hormone beta (LHB) (NM_000894) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216028 LHB (Myc-DDK-tagged)-Human luteinizing hormone beta polypeptide (LHB) 10 ug
$150.00
RC216028L1 Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), Myc-DDK-tagged 10 ug
$450.00
RC216028L2 Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), mGFP tagged 10 ug
$450.00
RC216028L3 Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), Myc-DDK-tagged 10 ug
$450.00
RC216028L4 Lenti ORF clone of Human luteinizing hormone beta polypeptide (LHB), mGFP tagged 10 ug
$450.00
SC300146 LHB (untagged)-Human luteinizing hormone beta polypeptide (LHB) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.