GSTA5 (NM_153699) Human Tagged ORF Clone

SKU
RC215990
GSTA5 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 5 (GSTA5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GSTA5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215990 representing NM_153699
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGAAGCCCAAGCTCCACTACTCCAATGCACGGGGCAGTATGGAGTCCATTCGGTGGCTCCTGG
CTGCAGCTGGAGTAGAGTTGGAAGAGAAATTTCTAGAATCTGCAGAAGATTTGGACAAGTTAAGAAATGA
TGGGAGTTTGCTGTTCCAGCAAGTACCAATGGTTGAGATTGACGGGATGAAGCTGGTGCAGACCAGAGCC
ATTCTTAACTACATTGCCAGCAAATACAACCTTTATGGGAAAGACATGAAGGAGAGAGCCCTGATTGATA
TGTACACAGAAGGTATAGTAGATTTGACTGAAATGATCCTTCTTCTGCTCATATGTCAACCAGAGGAAAG
AGATGCCAAGACTGCCTTGGTCAAAGAGAAAATAAAAAATCGCTACTTCCCTGCCTTTGAAAAAGTCTTA
AAGAGCCACAGACAAGACTACCTTGTTGGCAACAAGCTGAGCTGGGCTGACATTCACCTGGTGGAACTTT
TCTACTACGTGGAAGAGCTTGACTCGAGTCTTATCTCCAGCTTCCCTCTGCTGAAGGCCCTGAAAACCAG
AATCAGCAACCTGCCCACGGTGAAGAAGTTTCTGCAGCCTGGCAGCCAGAGAAAGCCTCCCATGGATGAG
AAATCTTTAGAAGAAGCAAGGAAGATTTTCAGGTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215990 representing NM_153699
Red=Cloning site Green=Tags(s)

MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRA
ILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVL
KSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDE
KSLEEARKIFRF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_153699
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153699.1, NP_714543.1
RefSeq Size 845 bp
RefSeq ORF 669 bp
Locus ID 221357
UniProt ID Q7RTV2
Cytogenetics 6p12.2
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
MW 25.5 kDa
Summary The glutathione S-transferases (GST; EC 2.5.1.18) catalyze the conjugation of reduced glutathiones and a variety of electrophiles, including many known carcinogens and mutagens. The cytosolic GSTs belong to a large superfamily, with members located on different chromosomes. For additional information on GSTs, see GSTA1 (MIM 138359).[supplied by OMIM, Sep 2008]
Write Your Own Review
You're reviewing:GSTA5 (NM_153699) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215990L1 Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), Myc-DDK-tagged 10 ug
$600.00
RC215990L2 Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), mGFP tagged 10 ug
$600.00
RC215990L3 Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), Myc-DDK-tagged 10 ug
$600.00
RC215990L4 Lenti ORF clone of Human glutathione S-transferase alpha 5 (GSTA5), mGFP tagged 10 ug
$600.00
RG215990 GSTA5 (tGFP-tagged) - Human glutathione S-transferase alpha 5 (GSTA5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC306643 GSTA5 (untagged)-Human glutathione S-transferase alpha 5 (GSTA5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.