OTUD4 (NM_017493) Human Tagged ORF Clone

SKU
RC214110
OTUD4 (Myc-DDK-tagged)-Human OTU domain containing 4 (OTUD4), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OTUD4
Synonyms DUBA6; HIN1; HSHIN1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214110 representing NM_017493
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGTATTCACTATCTTCGAGAGAACAGAGAGAAATTTGAAGCGTTTATAGAAGGATCATTTGAAG
AATATTTAAAGCGTTTGGAAAATCCACAGGAATGGGTAGGACAAGTGGAAATAAGTGCCCTTTCTCTTAT
GTACAGGAAAGATTTTATAATTTATCGGGAACCAAATGTTTCTCCTTCACAAGTAACAGAAAATAATTTT
CCTGAAAAGGTGTTACTGTGTTTTTCAAATGGAAATCATTATGATATTGTGTATCCCATAAAGTATAAAG
AAAGCTCTGCTATGTGTCAGTCTCTCCTTTATGAATTGCTGTATGAGAAGGTATTTAAAACTGATGTTAG
TAAAATTGTGATGGAACTAGACACGTTGGAAGTAGCTGATGAAGATAACAGTGAAATATCAGATTCAGAG
GATGACAGTTGCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214110 representing NM_017493
Red=Cloning site Green=Tags(s)

MACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNF
PEKVLLCFSNGNHYDIVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKIVMELDTLEVADEDNSEISDSE
DDSCK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017493
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017493.7
RefSeq Size 846 bp
RefSeq ORF 438 bp
Locus ID 54726
UniProt ID Q01804
Cytogenetics 4q31.21
Domains OTU
MW 17 kDa
Summary Alternatively spliced transcript variants have been found for this gene. The smaller protein isoform encoded by the shorter transcript variant is found only in HIV-1 infected cells. [provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:OTUD4 (NM_017493) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214110L3 Lenti-ORF clone of OTUD4 (Myc-DDK-tagged)-Human OTU domain containing 4 (OTUD4), transcript variant 2 10 ug
$465.00
RC214110L4 Lenti-ORF clone of OTUD4 (mGFP-tagged)-Human OTU domain containing 4 (OTUD4), transcript variant 2 10 ug
$465.00
RG214110 OTUD4 (tGFP-tagged) - Human OTU domain containing 4 (OTUD4), transcript variant 2 10 ug
$365.00
SC310667 OTUD4 (untagged)-Human OTU domain containing 4 (OTUD4), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.