NCALD (NM_001040625) Human Tagged ORF Clone

SKU
RC213925
NCALD (Myc-DDK-tagged)-Human neurocalcin delta (NCALD), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NCALD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213925 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAACAGAACAGCAAGCTGCGCCCGGAGGTCATGCAGGACTTGCTGGAAAGCACAGACTTTACAG
AGCATGAGATCCAGGAATGGTATAAAGGCTTCTTGAGAGACTGCCCCAGTGGACATTTGTCAATGGAAGA
GTTTAAGAAAATATATGGGAACTTTTTCCCTTATGGGGATGCTTCCAAATTTGCAGAGCATGTCTTCCGC
ACCTTCGATGCAAATGGAGATGGGACAATAGACTTTAGAGAATTCATCATCGCCTTGAGTGTAACTTCGA
GGGGGAAGCTGGAGCAGAAGCTGAAATGGGCCTTCAGCATGTACGACCTGGACGGAAATGGCTATATCAG
CAAGGCAGAGATGCTAGAGATCGTGCAGGCAATCTATAAGATGGTTTCCTCTGTAATGAAAATGCCTGAA
GATGAGTCAACCCCAGAGAAAAGAACAGAAAAGATCTTCCGCCAGATGGACACCAATAGAGACGGAAAAC
TCTCCATGGAAGAGTTCATCCGAGGAGCCAAAAGCGACCCGTCCATTGTGCGCCTCCTGCAGTGCGACCC
GAGCAGTGCCGGCCAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213925 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE
DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001040625
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001040625.1, NP_001035715.1
RefSeq Size 3673 bp
RefSeq ORF 582 bp
Locus ID 83988
UniProt ID P61601
Cytogenetics 8q22.3
MW 22.3 kDa
Summary This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NCALD (NM_001040625) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213925L3 Lenti-ORF clone of NCALD (Myc-DDK-tagged)-Human neurocalcin delta (NCALD), transcript variant 2 10 ug
$600.00
RC213925L4 Lenti-ORF clone of NCALD (mGFP-tagged)-Human neurocalcin delta (NCALD), transcript variant 2 10 ug
$600.00
RG213925 NCALD (tGFP-tagged) - Human neurocalcin delta (NCALD), transcript variant 2 10 ug
$500.00
SC311190 NCALD (untagged)-Human neurocalcin delta (NCALD), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.