Kallikrein 15 (KLK15) (NM_138564) Human Tagged ORF Clone

SKU
RC213756
KLK15 (Myc-DDK-tagged)-Human kallikrein-related peptidase 15 (KLK15), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Kallikrein 15
Synonyms ACO; HSRNASPH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213756 representing NM_138564
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCTTCTCCTCACTCTCTCCTTCCTGCTGGCATCCACAGCAGCCCAGGATGGTGACAAGTTGCTGG
AAGGTGACGAGTGTGCACCCCACTCCCAGCCATGGCAAGTGGCTCTCTACGAGCGTGGACGCTTTAACTG
TGGCGCTTCCCTCATCTCCCCACACTGGGTGCTGTCTGCGGCCCACTGCCAAAGCCGCTTCATGAGAGTG
CGCCTGGGAGAGCACAACCTGCGCAAGCGCGATGGCCCAGAGCAACTACGGACCACGTCTCGGGTCATTC
CACACCCGCGCTACGAAGCGCGCAGCCACCGCAACGACATCATGTTGCTGCGCCTAGTCCAGCCCGCACG
CCTGAACCCCCAGGGTGACTCTGGGGGACCCCTGGTCTGTGGGGGCATCCTGCAGGGCATTGTGTCCTGG
GGTGACGTCCCTTGTGACAACACCACCAAGCCTGGTGTCTATACCAAAGTCTGCCACTACTTGGAGTGGA
TCAGGGAAACCATGAAGAGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213756 representing NM_138564
Red=Cloning site Green=Tags(s)

MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRV
RLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQGDSGGPLVCGGILQGIVSW
GDVPCDNTTKPGVYTKVCHYLEWIRETMKRN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138564
ORF Size 513 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138564.1, NP_612631.1
RefSeq Size 1054 bp
RefSeq ORF 515 bp
Locus ID 55554
Cytogenetics 19q13.33
Protein Families Druggable Genome, Protease, Secreted Protein
MW 17.6 kDa
Summary Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. In prostate cancer, this gene has increased expression, which indicates its possible use as a diagnostic or prognostic marker for prostate cancer. The gene contains multiple polyadenylation sites and alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Kallikrein 15 (KLK15) (NM_138564) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213756L3 Lenti-ORF clone of KLK15 (Myc-DDK-tagged)-Human kallikrein-related peptidase 15 (KLK15), transcript variant 3 10 ug
$600.00
RC213756L4 Lenti-ORF clone of KLK15 (mGFP-tagged)-Human kallikrein-related peptidase 15 (KLK15), transcript variant 3 10 ug
$600.00
RG213756 KLK15 (tGFP-tagged) - Human kallikrein-related peptidase 15 (KLK15), transcript variant 3 10 ug
$500.00
SC306039 KLK15 (untagged)-Human kallikrein-related peptidase 15 (KLK15), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.