GADD45B (NM_015675) Human Tagged ORF Clone

SKU
RC213354
GADD45B (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GADD45B
Synonyms GADD45BETA; MYD118
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213354 representing NM_015675
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGCTGGAAGAGCTCGTGGCGTGCGACAACGCGGCGCAGAAGATGCAGACGGTGACCGCCGCGGTGG
AGGAGCTTTTGGTGGCCGCTCAGCGCCAGGATCGCCTCACAGTGGGGGTGTACGAGTCGGCCAAGTTGAT
GAATGTGGACCCAGACAGCGTGGTCCTCTGCCTCTTGGCCATTGACGAGGAGGAGGAGGATGACATCGCC
CTGCAAATCCACTTCACGCTCATCCAGTCCTTCTGCTGTGACAACGACATCAACATCGTGCGGGTGTCGG
GCAATGCGCGCCTGGCGCAGCTCCTGGGAGAGCCGGCCGAGACCCAGGGCACCACCGAGGCCCGAGACCT
CCACTGTCTTCCCTTCCTACAGAACCCTCACACGGACGCCTGGAAGAGCCACGGCTTGGTGGAGGTGGCC
AGCTACTGCGAAGAAAGCCGGGGCAACAACCAGTGGGTCCCCTACATCTCTCTTCAGGAACGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213354 representing NM_015675
Red=Cloning site Green=Tags(s)

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA
LQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVA
SYCEESRGNNQWVPYISLQER

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015675
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015675.1, NP_056490.1
RefSeq Size 1121 bp
RefSeq ORF 483 bp
Locus ID 4616
UniProt ID O75293
Cytogenetics 19p13.3
Domains Ribosomal_L7Ae
Protein Families Druggable Genome
Protein Pathways Cell cycle, MAPK signaling pathway, p53 signaling pathway
MW 17.6 kDa
Summary This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GADD45B (NM_015675) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213354L1 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged 10 ug
$450.00
RC213354L2 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged 10 ug
$450.00
RC213354L3 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged 10 ug
$450.00
RC213354L4 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged 10 ug
$450.00
RG213354 GADD45B (tGFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B) 10 ug
$489.00
SC114608 GADD45B (untagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.